[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE38782.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1uiyA.bssp"
#ERROR : Can't open dsspfile "1dciA.bssp"
#ERROR : Can't open dsspfile "1dubA.bssp"
#ERROR : Can't open dsspfile "1wdkA4.bssp"
#ERROR : Can't open dsspfile "1jxzA.bssp"
#ERROR : Can't open dsspfile "1hzdA.bssp"
#ERROR : Can't open dsspfile "1q51A.bssp"
#ERROR : Can't open dsspfile "1ef8A.bssp"
#ERROR : Can't open dsspfile "2a7kA1.bssp"
#ERROR : Can't open dsspfile "1hnoA.bssp"
#ERROR : Can't open dsspfile "1wz8A1.bssp"
#ERROR : Can't open dsspfile "2f6qA1.bssp"
#ERROR : Can't open dsspfile "1o8uA.bssp"
#ERROR : Can't open dsspfile "1sg4A1.bssp"
#ERROR : Can't open dsspfile "1pixA2.bssp"
#ERROR : Can't open dsspfile "1od2A2.bssp"
#ERROR : Can't open dsspfile "1pixA3.bssp"
#ERROR : Can't open dsspfile "1tg6A1.bssp"
#ERROR : Can't open dsspfile "2f9yA1.bssp"
#ERROR : Can't open dsspfile "1u5tB1.bssp"
#ERROR : Can't open dsspfile "1dfcA3.bssp"
#ERROR : Can't open dsspfile "2f9yB1.bssp"
#ERROR : Can't open dsspfile "1cjdA2.bssp"

## Summary of PDB Search
:258
    2e-50  29%  1uiyA  [c.14.1.3] ENOYL-COA HYDRATASE
    3e-49  27%  1dciA  [c.14.1.3] DIENOYL-COA ISOMERASE
    4e-49  39%  1dubA  [c.14.1.3] 2-ENOYL-COA HYDRATASE
    1e-48  22%  1wdkA4 [c.14.1.3] FATTY OXIDATION COMPLEX ALPHA SUBUNIT A:1 -- 310
    9e-48  25%  1jxzA  [c.14.1.3] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
    3e-47  30%  1hzdA  [c.14.1.3] AU-BINDING PROTEIN/ENOYL-COA HYDRATASE
    2e-46  24%  1q51A  [c.14.1.3] MENB
    2e-44  24%  1ef8A  [c.14.1.3] METHYLMALONYL COA DECARBOXYLASE
    4e-41  21%  2a7kA1 [c.14.1.3] CARB A:1 -- 230
    7e-41  19%  1hnoA  [c.14.1.3] D3,D2-ENOYL COA ISOMERASE ECI1
    5e-40  24%  1wz8A1 [c.14.1.3] ENOYL-COA HYDRATASE A:2 -- 264
    2e-39  21%  2f6qA1 [c.14.1.3] PEROXISOMAL 3,2-TRANS-ENOYL-COA ISOMERASE A:108
    7e-37  22%  1o8uA  [c.14.1.3] 6-OXO CAMPHOR HYDROLASE
    5e-34  15%  1sg4A1 [c.14.1.3] 3,2-TRANS-ENOYL-COA ISOMERASE, MITOCHONDRIAL A:2
    3e-28  10%  1pixA2 [c.14.1.4] GLUTACONYL-COA DECARBOXYLASE A SUBUNIT A:1 --
    2e-25  11%  1od2A2 [c.14.1.4] ACETYL-COENZYME A CARBOXYLASE A:1815 -- 2203
    2e-19   6%  1pixA3 [c.14.1.4] GLUTACONYL-COA DECARBOXYLASE A SUBUNIT A:288 --
    2e-18  16%  1tg6A1 [c.14.1.1] PUTATIVE ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC
    5e-15  16%  2f9yA1 [c.14.1.4] ACETYL-COA CARBOXYLASE, CARBOXYLTRANSFERASE A:4
    2e-13  19%  1u5tB1 [a.4.5.54] DEFECTIVE IN VACUOLAR PROTEIN SORTING VPS36P
    6e-13  11%  1dfcA3 [b.42.5.1] FASCIN A:1260 -- 1382
    2e-09  16%  2f9yB1 [c.14.1.4] ACETYL-COENZYME A CARBOXYLASE CARBOXYL B:23 --
    5e-09   5%  1cjdA2 [b.121.2.1] PROTEIN (MAJOR CAPSID PROTEIN (P3)) A:245 -- 383
:258

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPENVIIVEREGRVGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
1uiyA           ---------EKGHVAVVFLNDPERRNPLSPEXALSLLQALDDLEADPGVRAVVLTGRGKAFSAGADLAFL
1dciA           --ESIQVTSAQKHVLHVQLNRPEKRNAMNRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMASDI
1dubA           ----TEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM
1wdkA4          --KAITVTALESGIVELKFDKGESVNKFNRLTLNELRQAVDAIKADASVKGVIVSSGKDVFIVGADITEF
1jxzA           -----IGHRVEDGVAEITIKLPRHRNALSVKAMQEVTDALNRAEEDDSVGAVMITGAEDAFCAGFYLREI
1hzdA           -LRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKE
1q51A           LTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCS
1ef8A           MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDIHE
2a7kA1          ----MVFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNE
1hnoA           -----ISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKET
1wz8A1          -----LAFAWPRPGVLEITFRGEKLNAMPPALHRGLARVWRDLEAVEGVRAVLLRGEGGVFSAGGSFGLI
2f6qA1          -----LVVTSEDGITKIXFNRPKKKNAINTEXYHEIXRALKAASKDDSIITVLTGNGDYYSSGNDLDIPP
1o8uA           -----IRLERDGGVLLVTVHTEGKSLVWTSTAHDELAYCFHDIACDRENKVVILTGTGPSFCNEIDFTSF
1sg4A1          -----VLVEPDAGAGVMKFKNPPV-NSLSLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLDLTE
1pixA2          -----LGRVNGKWCVVVASDNKKLAGAWVPGQAECLLRASDTAKTLHVPLVYVLNCSGVKFDEQEKVYPN
1od2A2          ----LGVIGVETRTVENLIPADPANPNSAETLIQEPGQVWHPNSAFKTAQAINDFNNGEQLPXXILANWR
1pixA3          ----------MNYPEYKAAGSVGIGGKLYRQGLVKMNEFVTLCARDRLPIVWIQDTTGIDVG--------
1tg6A1          IPVVYDIYSRLLRERIVCVM-----GPIDDSVASLVIAQLLFLQSESNKKPIHM----------------
2f9yA1          ----------------------------------------------------------------------
1u5tB1          ----------------------------------------------------------------------
1dfcA3          -------------VVLQAANERN-VSTMDLSANQDEETDQETFQLEIDRDTKKCAFRTHTGKYWTLTATG
2f9yB1          ----------------------------------------------------------------------
1cjdA2          -------------LPLIDLSTLYNLNSAQAGLTPNVDFVVQYANLYRYLSTIAVFDNGGSFNAGTDINYL


                         .         .         *         .         .         .         .:140
query           XEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPG
1uiyA           ERVTELGAEESLSLXRLFHRVYTYPKPTVAAVNGPAVAGGAGLALACDLVVXDEEARLGYTEVKIGFVAA
1dciA           LQPPGDDVARIAWYLRDLISIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVKEVDVGLAAD
1dubA           QNRTFQDCYSGKFL-SHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPG
1wdkA4          VENFKLPDAELIAGNLEFSDFEDLNVPTVAAINGIALGGGLEMCLAADFRVMADSAKIGLPEVKLGIYPG
1jxzA           PLDKGVAGVRDHFWQQMIHKIIRVKRPVLAAINGVAAGGGLGISLASDMAICADSAKFVCAWHTIGIGND
1hzdA           RAKMSSSEVGPFVIRAVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVETKLAIIPG
1q51A           GGDQ-------LHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGSFDG
1ef8A           ----LDPLSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYN
2a7kA1          VKQLRSEDIEEWIVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
1hnoA           SKWVSNFVARNVYVTDAFI---KHSKVLICCLNGPAIGLSAALVALCDIVYSIDKVYLLYPFANLGLITE
1wz8A1          EEMRASHEALLRVFWEARDLVLGPLRPVVAAVEKVAVGAGLALALAADIAVVGKGTRLLDGHLRLGVAAG
2f6qA1          GGVEEKAKNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPE
1o8uA           NLGTPHDWDEIIFGQRLLNNLLSIEVPVIAAVNG-PVTNHPEIPVMSDIVLAAESATFQGPHFPSGIVPG
1sg4A1          MCGRSPAHYAGYWVQELWLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYGLNETQLGIIAP
1pixA2          RRGGGT-------PFFRNAELNQLGIPVIVGIYGTNPAGGGYHSISPTVIIAHEKANMAVAGIMGGMNPK
1od2A2          GFSGGQRDXFNEVLKFIVDALVDYKQPIIIYIPPTGELRGGSWVVVDPTINADQXEXYADVNARAGVLEP
1pixA3          --NDAEKAELLGLGQSLIYSIQTSHIPQFEITLRKG-TAAAHYVLGGPQGNDTNAFSIGTAATEIAVMNG
1tg6A1          --YINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLAGTPGMRHSLPNSRIMIHQPSGGARGQ
2f9yA1          ------------AIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPE-----G
1u5tB1          -----------------KDLNSDTNYMIITLVDLYAMRIGTGLISPMEMREACRFEHLGLNELKLVKVNK
1dfcA3          GVQSTASSKNAS---CYFDIEWRDRRITLRASNGKFVTSKKNGQLAASVETAGDSELFLMKLI-------
2f9yB1          ------------KTSAALAKMQERGLPYISVLTDPTMGGVSSFAMLGDLNIAEPKALIGFAG--------
1cjdA2          SQRTANFSDTRKLDPKTWTDFPKGVYYCDNRDKPIYTLQYGNVGFVVNPKTVNQNARLLMGY--------


                         +         .         .         .         .         *         .:210
query           AGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE
1uiyA           -LVSVILVRAVGEKAAKDLLLTGRLVEAREAKALGLVNRIAPPGKALEEAKALAEEVAKNAPTSLRLTKE
1dciA           VGTLQRLPKVIGRSLVNELTFTARKMMADEALDSGLVSRVFDKDVMLNAAFALAADISSKSPVAVQGSKI
1dubA           AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKE
1wdkA4          FGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVSAVDAVVTADKLGAAALDLIKRAISGELDYKAKRQP
1jxzA           TATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKE
1hzdA           GGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKAREFLPQGPVAMRVAKL
1q51A           GYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKF
1ef8A           LVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE
2a7kA1          VGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
1hnoA           GGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFELREKVKGLYLPSCLGMKD
1wz8A1          DHAVLLWPLLVGMAKAKYHLLLNEPLTGEEAERLGLVALAVEDEKVYEKALEVAERLAQGPKEALHHTKH
2f6qA1          GCSSYTFPKIXSPAKATEXLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKE
1o8uA           DGAHVVWPHVLGSNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEKPLLARRYARK
1sg4A1          FWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTALSAIAQWMAIPDHARQLTKA
1pixA2          GHVDLEYANEIADMVDRTGKTEPPGAVDIHYTETGFMREVYASE---EGVLEGIKKYVGML---------
1od2A2          QGXVGIKFRREKLLDTXNR-----LDDKYRELRSQLSNKSLAPEVHQQISKQLADRERELLPIYGQISLQ
1pixA3          ETAATAMYSRRLAKDRKLIQAFYTKSRPKVCAELGLVDEIVDMNKIR-GYVEAFTEAAYQNPESICPFHQ
1tg6A1          ATDIAIQAEEIMKLKIESAMERDRYMSPMEAQEFGILDKVLVH---------------------------
2f9yA1          CASILWKSADKAPLAAEAM-----GIIRPRLKELKLIDSIIPEPLGGAHRNPEAM---------------
1u5tB1          ----------------------------------------------------------------------
1dfcA3          ----------------------------------------------------------------------
2f9yB1          -------PRVIEQTVREK--LPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAP-------
1cjdA2          ---EYFTSR-------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSFVHR
1uiyA           LLLALPGXGLEDGFRLAALANAWVRETGDLAEGIRAFFEKRPPRF---
1dciA           NLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKKDSKSI--
1dubA           SVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANF---
1wdkA4          KLEKLKLNAIEQMMAFETAKGFVAQAGPNYPAPVEAIKTIQKAANFGR
1jxzA           RFHAGWMQPVEECTEFEIQNVIASVTHPHFMPCLTRFLDGHRADR---
1hzdA           AINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKG-
1q51A           AFNLLDD-GLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDWSP-
1ef8A           ELRVLGEAHTMNSDEFERGMRRAVYDSEDYQEGMNAFLEKRKPNF---
2a7kA1          AVNKPFIHLLEQTRDASKA-----------------------------
1hnoA           AFNKANSVEVNESLKY--------------------------------
1wz8A1          ALNHWYRSFL-PHFELSLALEFLGFSGKELEEGLKALKEKRPPEF---
2f6qA1          VIRKREREKLHAVNAEECNVLQGRWLSDEC------------------
1o8uA           VLTRQLRRVMEADLSLGLA--HEALAAID-------------------
1sg4A1          MMRKATASRLVTQRDADVQNFVSFISKDSIQKSLQ-------------
1pixA2          ------------------------------------------------
1od2A2          FADKELEWTEARRFFFWRKRLSHQVGEASRLEKIARIRSWY-------
1pixA3          MILPRAIREFETFV----------------------------------
1tg6A1          ------------------------------------------------
2f9yA1          ------------------------------------------------
1u5tB1          ------------------------------------------------
1dfcA3          ------------------------------------------------
2f9yB1          ------------------------------------------------
1cjdA2          ------------------------------------------------