[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE39205.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ohgA.bssp"
#ERROR : Can't open dsspfile "1rq0A.bssp"

## Summary of PDB Search
:431
    9e-33  16%  1ohgA  [d.183.1.1] MAJOR CAPSID PROTEIN
    5e-05  16%  1rq0A  [e.38.1.1] PEPTIDE CHAIN RELEASE FACTOR 1[MASQUE : MEMB(X) 0
:431

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxETKAGIAGDDAQQVYDALMRTFEDYKAENDSRLQAIEKRGGDVIAEDK
1ohgA           ----------------------------------------------------------------------
1rq0A           ----------------------EIRPGTGGEEAALFARDLFRMYTRYAERKGWNLEVAEIHETDLGGREV


                         .         .         *         .         .         .         .:140
query           VARIDAALNAQQRRLDELALKQARPQLGADSALRPRGAAEHKSAFDAYIRNGDAATLRQIETKALSVGSN
1ohgA           -------------------------------------------------------------------SDA
1rq0A           VFFVKG-------KNAYGILKYESGRVQRVPVTESGGRIHTSTATVAVLPEIEEKDI-EIRPEDLKIETF


                         +         .         .         .         .         *         .:210
query           PDGGYLVPEELERSIAARLSAISPIRGLASVRQISGSVYKKPFMTAGPATGWVGEAAARPQTSSPTLDAL
1ohgA           DSAGSLIQPMQIPGIIMPGLRRLTIRDLLAQGRTSSNALEYVREEVFTNNDVVAEKALKPESD-ITFSKQ
1rq0A           R-ASGYVN---KTESAVRITHLPTGIVVSCQNERS-----------------------------------


                         .         .         .         +         .         .         .:280
query           SFPAMELYAMPXXXXXXXXXXXVNLDDWLTGEIDTVFAEQEGAAFVSGDGINKPKGFLAAPTVANAAWSW
1ohgA           TANVKTIAHWVQASRQVMDDA-PMLQSYINNRLMYGLALKEEGQLLNGDGTGDNLEGLNKVATAYDT---
1rq0A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GNLGFVATGAAGAFPASNPSDVLIDLMFALKPGYRQNASFVMNRRTQAAIRKFKDNNGVYLWQPPATASG
1ohgA           ----------SLNATGDTRADIIAHAIYQVTESEFSASGIVLNPRDWHNIALLKDNEGRYIFGGP-QAFT
1rq0A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RASLIGFPLADAEDMPDIAANSLAIAFGDFRRGYLIVDRQGVRVLRDPYSAKPYVLFYTTKRVGGGVQDF
1ohgA           SNIMWGLPVVPTKAQAA-----GTFTVGGFDMASQVWDRMDATVEVSREDRDNFLTILCEERLALAHYRP
1rq0A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           DAIKLLKFxxx
1ohgA           TAIIKGTF---
1rq0A           -----------