[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE39246.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bhgA1.bssp"
#ERROR : Can't open dsspfile "1ky9A2.bssp"
#ERROR : Can't open dsspfile "1mbmA.bssp"
#ERROR : Can't open dsspfile "1lvbA.bssp"
#ERROR : Can't open dsspfile "1nf3C.bssp"
#ERROR : Can't open dsspfile "1befA.bssp"
#ERROR : Can't open dsspfile "1ogsA1.bssp"
#ERROR : Can't open dsspfile "1ky9A1.bssp"
#ERROR : Can't open dsspfile "1ep5A.bssp"
#ERROR : Can't open dsspfile "1q3oA.bssp"
#ERROR : Can't open dsspfile "1t16A.bssp"
#ERROR : Can't open dsspfile "1qy6A.bssp"
#ERROR : Can't open dsspfile "2i4sA1.bssp"
#ERROR : Can't open dsspfile "1m5q1.bssp"
#ERROR : Can't open dsspfile "1lcyA1.bssp"
#ERROR : Can't open dsspfile "1rzxA.bssp"
#ERROR : Can't open dsspfile "1v62A.bssp"
#ERROR : Can't open dsspfile "1y8tA1.bssp"
#ERROR : Can't open dsspfile "1ky9B2.bssp"
#ERROR : Can't open dsspfile "1x5nA1.bssp"
#ERROR : Can't open dsspfile "2cs5A1.bssp"
#ERROR : Can't open dsspfile "1be9A.bssp"
#ERROR : Can't open dsspfile "1k32A1.bssp"
#ERROR : Can't open dsspfile "2hgaA1.bssp"
#ERROR : Can't open dsspfile "1sotA1.bssp"
#ERROR : Can't open dsspfile "1wifA.bssp"
#ERROR : Can't open dsspfile "1fc6A3.bssp"
#ERROR : Can't open dsspfile "1qauA.bssp"
#ERROR : Can't open dsspfile "1n99A2.bssp"
#ERROR : Can't open dsspfile "1m5zA.bssp"
#ERROR : Can't open dsspfile "1agjA.bssp"
#ERROR : Can't open dsspfile "2f5yA1.bssp"
#ERROR : Can't open dsspfile "1fc6A4.bssp"
#ERROR : Can't open dsspfile "1ihjA.bssp"
#ERROR : Can't open dsspfile "1u37A1.bssp"
#ERROR : Can't open dsspfile "1n99A1.bssp"
#ERROR : Can't open dsspfile "1kwaA.bssp"
#ERROR : Can't open dsspfile "1sozC1.bssp"
#ERROR : Can't open dsspfile "1n7eA.bssp"
#ERROR : Can't open dsspfile "1he1A.bssp"
#ERROR : Can't open dsspfile "1v6bA.bssp"
#ERROR : Can't open dsspfile "1j7xA.bssp"
#ERROR : Can't open dsspfile "1u39A1.bssp"
#ERROR : Can't open dsspfile "1vaeA.bssp"
#ERROR : Can't open dsspfile "1p3cA.bssp"
#ERROR : Can't open dsspfile "1a1r.1.bssp"
#ERROR : Can't open dsspfile "1nf3C.bssp"
#ERROR : Can't open dsspfile "1ky9A1.bssp"
#ERROR : Can't open dsspfile "1q3oA.bssp"
#ERROR : Can't open dsspfile "2i4sA1.bssp"
#ERROR : Can't open dsspfile "1lcyA1.bssp"
#ERROR : Can't open dsspfile "1rzxA.bssp"
#ERROR : Can't open dsspfile "1y8tA1.bssp"
#ERROR : Can't open dsspfile "1ky9B2.bssp"
#ERROR : Can't open dsspfile "1x5nA1.bssp"
#ERROR : Can't open dsspfile "1be9A.bssp"
#ERROR : Can't open dsspfile "1k32A1.bssp"
#ERROR : Can't open dsspfile "2hgaA1.bssp"
#ERROR : Can't open dsspfile "1sotA1.bssp"
#ERROR : Can't open dsspfile "1qauA.bssp"
#ERROR : Can't open dsspfile "1n99A2.bssp"
#ERROR : Can't open dsspfile "1m5zA.bssp"
#ERROR : Can't open dsspfile "2f5yA1.bssp"
#ERROR : Can't open dsspfile "1fc6A4.bssp"
#ERROR : Can't open dsspfile "1u37A1.bssp"
#ERROR : Can't open dsspfile "1n99A1.bssp"
#ERROR : Can't open dsspfile "1he1A.bssp"
#ERROR : Can't open dsspfile "1u39A1.bssp"
#ERROR : Can't open dsspfile "1vaeA.bssp"

## Summary of PDB Search
:526
    1e-33  20%  2bhgA1 [b.47.1.4] FOOT-AND-MOUTH DISEASE VIRUS 3C PROTEASE A:7 --
    2e-30  44%  1ky9A2 [b.47.1.1] PROTEASE DO A:11 -- 259
    3e-29  14%  1mbmA  [b.47.1.3] CHYMOTRYPSIN-LIKE SERINE PROTEASE
    2e-28  17%  1lvbA  [b.47.1.3] CATALYTIC DOMAIN OF THE NUCLEAR INCLUSION
    1e-23  18%  1nf3C  [b.36.1.1] PAR-6B
    3e-22  20%  1befA  [b.47.1.3] DENGUE VIRUS NS3 SERINE PROTEASE
    1e-20  12%  1ogsA1 [b.71.1.2] GLUCOSYLCERAMIDASE A:1 -- 77 A:432 -- 497
    1e-18  34%  1ky9A1 [b.36.1.4] PROTEASE DO A:260 -- 353
    6e-17  15%  1ep5A  [b.47.1.3] CAPSID PROTEIN C
    2e-16  23%  1q3oA  [b.36.1.1] SHANK1
    2e-16  13%  1t16A  [f.4.3.4] LONG-CHAIN FATTY ACID TRANSPORT PROTEIN
    5e-16  22%  1qy6A  [b.47.1.1] SERINE PROTEASE
    2e-15  20%  2i4sA1 [b.36.1.5] GENERAL SECRETION PATHWAY PROTEIN C A:204 -- 305
    4e-15  11%  1m5q1  [b.38.1.1] SMALL NUCLEAR RIBONUCLEOPROTEIN HOMOLOG
    6e-15  26%  1lcyA1 [b.36.1.4] HTRA2 SERINE PROTEASE A:226 -- 325
    2e-14  22%  1rzxA  [b.36.1.1] CG5884-PA
    3e-13  13%  1v62A  [b.36.1.1] KIAA1719 PROTEIN
    3e-13  37%  1y8tA1 [b.36.1.4] HYPOTHETICAL PROTEIN RV0983 A:227 -- 314
    1e-11  26%  1ky9B2 [b.36.1.4] PROTEASE DO B:359 -- 446
    1e-11  19%  1x5nA1 [b.36.1.1] HARMONIN A:8 -- 108
    2e-11  11%  2cs5A1 [b.36.1.1] TYROSINE-PROTEIN PHOSPHATASE, NON-RECEPTOR TYPE
    3e-11  23%  1be9A  [b.36.1.1] PSD-95
    1e-10  18%  1k32A1 [b.36.1.3] TRICORN PROTEASE A:763 -- 853
    3e-10  19%  2hgaA1 [b.36.1.6] CONSERVED PROTEIN MTH1368 A:23 -- 125
    4e-10  36%  1sotA1 [b.36.1.4] PROTEASE DEGS A:255 -- 353
    1e-09  14%  1wifA  [b.36.1.1] RIKEN CDNA 4930408O21
    2e-09  34%  1fc6A3 [b.36.1.3] PHOTOSYSTEM II D1 PROTEASE A:157 -- 248
    3e-09  19%  1qauA  [b.36.1.1] NEURONAL NITRIC OXIDE SYNTHASE (RESIDUES 1-130)
    7e-09  15%  1n99A2 [b.36.1.1] SYNTENIN 1 A:195 -- 273
    2e-08  19%  1m5zA  [b.36.1.1] AMPA RECEPTOR INTERACTING PROTEIN
    3e-08  21%  1agjA  [b.47.1.1] EPIDERMOLYTIC TOXIN A
    4e-08  19%  2f5yA1 [b.36.1.1] REGULATOR OF G-PROTEIN SIGNALLING 3 ISOFORM 1
    5e-08   7%  1fc6A4 [c.14.1.2] PHOTOSYSTEM II D1 PROTEASE A:78 -- 156 A:249 --
    5e-08  22%  1ihjA  [b.36.1.1] INAD
    5e-08  28%  1u37A1 [b.36.1.1] AMYLOID BETA A4 PRECURSOR PROTEIN-BINDING, A:19
    2e-07  23%  1n99A1 [b.36.1.1] SYNTENIN 1 A:112 -- 194
    5e-07  16%  1kwaA  [b.36.1.1] HCASK/LIN-2 PROTEIN
    6e-07  25%  1sozC1 [b.36.1.4] PROTEASE DEGS C:255 -- 353
    2e-06  20%  1n7eA  [b.36.1.1] AMPA RECEPTOR INTERACTING PROTEIN GRIP
    5e-06  15%  1he1A  [a.24.11.1] EXOENZYME S
    5e-06  21%  1v6bA  [b.36.1.1] HARMONIN ISOFORM A1
    7e-06  10%  1j7xA  [c.14.1.2] INTERPHOTORECEPTOR RETINOID-BINDING PROTEIN
    2e-05  18%  1u39A1 [b.36.1.1] AMYLOID BETA A4 PRECURSOR PROTEIN-BINDING, A:79
    2e-05  33%  1vaeA  [b.36.1.1] RHOPHILIN, RHO GTPASE BINDING PROTEIN 2
    3e-04  23%  1p3cA  [b.47.1.1] GLUTAMYL-ENDOPEPTIDASE
    3e-04  32%  1a1r.1 [b.47.1.3] NS3 PROTEIN A:- -- - C:- -- -
    3e-04  16%  1nf3C  [b.36.1.1] PAR-6B(query 437->512)
    5e-07  28%  1ky9A1 [b.36.1.4] PROTEASE DO A:260 -- 353(query 434->520)
    1e-05  24%  1q3oA  [b.36.1.1] SHANK1(query 450->508)
    2e-08  16%  2i4sA1 [b.36.1.5] GENERAL SECRETION PATHWAY PROTEIN C A:204 -- 305(query 434->508)
    8e-06  29%  1lcyA1 [b.36.1.4] HTRA2 SERINE PROTEASE A:226 -- 325(query 450->520)
    3e-04  15%  1rzxA  [b.36.1.1] CG5884-PA(query 437->508)
    3e-05  23%  1y8tA1 [b.36.1.4] HYPOTHETICAL PROTEIN RV0983 A:227 -- 314(query 434->524)
    5e-07  27%  1ky9B2 [b.36.1.4] PROTEASE DO B:359 -- 446(query 450->513)
    3e-05  22%  1x5nA1 [b.36.1.1] HARMONIN A:8 -- 108(query 436->520)
    2e-05  20%  1be9A  [b.36.1.1] PSD-95(query 446->526)
    6e-04  18%  1k32A1 [b.36.1.3] TRICORN PROTEASE A:763 -- 853(query 456->520)
    4e-05  22%  2hgaA1 [b.36.1.6] CONSERVED PROTEIN MTH1368 A:23 -- 125(query 451->520)
    4e-09  29%  1sotA1 [b.36.1.4] PROTEASE DEGS A:255 -- 353(query 448->499)
    4e-06  19%  1qauA  [b.36.1.1] NEURONAL NITRIC OXIDE SYNTHASE (RESIDUES 1-130)(query 436->524)
    3e-06  24%  1n99A2 [b.36.1.1] SYNTENIN 1 A:195 -- 273(query 453->497)
    2e-06  24%  1m5zA  [b.36.1.1] AMPA RECEPTOR INTERACTING PROTEIN(query 436->508)
    2e-04  20%  2f5yA1 [b.36.1.1] REGULATOR OF G-PROTEIN SIGNALLING 3 ISOFORM 1(query 450->508)
    3e-04   8%  1fc6A4 [c.14.1.2] PHOTOSYSTEM II D1 PROTEASE A:78 -- 156 A:249 --(query 448->510)
    1e-04  18%  1u37A1 [b.36.1.1] AMYLOID BETA A4 PRECURSOR PROTEIN-BINDING, A:19(query 431->508)
    5e-06  22%  1n99A1 [b.36.1.1] SYNTENIN 1 A:112 -- 194(query 450->508)
    4e-05   9%  1he1A  [a.24.11.1] EXOENZYME S(query 429->524)
    3e-04  17%  1u39A1 [b.36.1.1] AMYLOID BETA A4 PRECURSOR PROTEIN-BINDING, A:79(query 453->498)
    1e-04  31%  1vaeA  [b.36.1.1] RHOPHILIN, RHO GTPASE BINDING PROTEIN 2(query 450->511)
:526

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bhgA1          ----------------------------------------------------------------------
1ky9A2          ----------------------------------------------------------------------
1mbmA           ----------------------------------------------------------------------
1lvbA           ----------------------------------------------------------------------
1nf3C           ----------------------------------------------------------------------
1befA           ----------------------------------------------------------------------
1ogsA1          ----------------------------------------------------------------------
1ky9A1          ----------------------------------------------------------------------
1ep5A           ----------------------------------------------------------------------
1q3oA           ----------------------------------------------------------------------
1t16A           ----------------------------------------------------------------------
1qy6A           ----------------------------------------------------------------------
2i4sA1          ----------------------------------------------------------------------
1m5q1           ----------------------------------------------------------------------
1lcyA1          ----------------------------------------------------------------------
1rzxA           ----------------------------------------------------------------------
1v62A           ----------------------------------------------------------------------
1y8tA1          ----------------------------------------------------------------------
1ky9B2          ----------------------------------------------------------------------
1x5nA1          ----------------------------------------------------------------------
2cs5A1          ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
1k32A1          ----------------------------------------------------------------------
2hgaA1          ----------------------------------------------------------------------
1sotA1          ----------------------------------------------------------------------
1wifA           ----------------------------------------------------------------------
1fc6A3          ----------------------------------------------------------------------
1qauA           ----------------------------------------------------------------------
1n99A2          ----------------------------------------------------------------------
1m5zA           ----------------------------------------------------------------------
1agjA           ----------------------------------------------------------------------
2f5yA1          ----------------------------------------------------------------------
1fc6A4          ----------------------------------------------------------------------
1ihjA           ----------------------------------------------------------------------
1u37A1          ----------------------------------------------------------------------
1n99A1          ----------------------------------------------------------------------
1kwaA           ----------------------------------------------------------------------
1sozC1          ----------------------------------------------------------------------
1n7eA           ----------------------------------------------------------------------
1he1A           ----------------------------------------------------------------------
1v6bA           ----------------------------------------------------------------------
1j7xA           ----------------------------------------------------------------------
1u39A1          ----------------------------------------------------------------------
1vaeA           ----------------------------------------------------------------------
1p3cA           ----------------------------------------------------------------------
1a1r.1          ----------------------------------------------------------------------
1nf3C           ----------------------------------------------------------------------
1ky9A1          ----------------------------------------------------------------------
1q3oA           ----------------------------------------------------------------------
2i4sA1          ----------------------------------------------------------------------
1lcyA1          ----------------------------------------------------------------------
1rzxA           ----------------------------------------------------------------------
1y8tA1          ----------------------------------------------------------------------
1ky9B2          ----------------------------------------------------------------------
1x5nA1          ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
1k32A1          ----------------------------------------------------------------------
2hgaA1          ----------------------------------------------------------------------
1sotA1          ----------------------------------------------------------------------
1qauA           ----------------------------------------------------------------------
1n99A2          ----------------------------------------------------------------------
1m5zA           ----------------------------------------------------------------------
2f5yA1          ----------------------------------------------------------------------
1fc6A4          ----------------------------------------------------------------------
1u37A1          ----------------------------------------------------------------------
1n99A1          ----------------------------------------------------------------------
1he1A           ----------------------------------------------------------------------
1u39A1          ----------------------------------------------------------------------
1vaeA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QPVGFADIVEKVKPSVISVKVNIAEKTAKNEDRAEDSPFQPGSPMERFFRRFXXXXXXXXXXXXXXXXXX
2bhgA1          ----------------------------------------------------------------------
1ky9A2          QXPSLAPXLEKVXPSVVSI---NVEGSTTVNTPRXPRNFQQGGQQQKFX---------------------
1mbmA           ----------------------------------------------------------------------
1lvbA           ----------------------------------------------------------------------
1nf3C           ----------------------------------------------------------------------
1befA           ----------------------------------------------------------------------
1ogsA1          ----------------------------------------------------------------------
1ky9A1          ----------------------------------------------------------------------
1ep5A           ----------------------------------------------------------------------
1q3oA           ----------------------------------------------------------------------
1t16A           ----------------------------------------------------------------------
1qy6A           ----------------------------------------------------------------------
2i4sA1          ----------------------------------------------------------------------
1m5q1           ----------------------------------------------------------------------
1lcyA1          ----------------------------------------------------------------------
1rzxA           ----------------------------------------------------------------------
1v62A           ----------------------------------------------------------------------
1y8tA1          ----------------------------------------------------------------------
1ky9B2          ----------------------------------------------------------------------
1x5nA1          ----------------------------------------------------------------------
2cs5A1          ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
1k32A1          ----------------------------------------------------------------------
2hgaA1          ----------------------------------------------------------------------
1sotA1          ----------------------------------------------------------------------
1wifA           ----------------------------------------------------------------------
1fc6A3          ----------------------------------------------------------------------
1qauA           ----------------------------------------------------------------------
1n99A2          ----------------------------------------------------------------------
1m5zA           ----------------------------------------------------------------------
1agjA           ----------------------------------------------------------------------
2f5yA1          ----------------------------------------------------------------------
1fc6A4          ----------------------------------------------------------------------
1ihjA           ----------------------------------------------------------------------
1u37A1          ----------------------------------------------------------------------
1n99A1          ----------------------------------------------------------------------
1kwaA           ----------------------------------------------------------------------
1sozC1          ----------------------------------------------------------------------
1n7eA           ----------------------------------------------------------------------
1he1A           ----------------------------------------------------------------------
1v6bA           ----------------------------------------------------------------------
1j7xA           ----------------------------------------------------------------------
1u39A1          ----------------------------------------------------------------------
1vaeA           ----------------------------------------------------------------------
1p3cA           ----------------------------------------------------------------------
1a1r.1          ----------------------------------------------------------------------
1nf3C           ----------------------------------------------------------------------
1ky9A1          ----------------------------------------------------------------------
1q3oA           ----------------------------------------------------------------------
2i4sA1          ----------------------------------------------------------------------
1lcyA1          ----------------------------------------------------------------------
1rzxA           ----------------------------------------------------------------------
1y8tA1          ----------------------------------------------------------------------
1ky9B2          ----------------------------------------------------------------------
1x5nA1          ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
1k32A1          ----------------------------------------------------------------------
2hgaA1          ----------------------------------------------------------------------
1sotA1          ----------------------------------------------------------------------
1qauA           ----------------------------------------------------------------------
1n99A2          ----------------------------------------------------------------------
1m5zA           ----------------------------------------------------------------------
2f5yA1          ----------------------------------------------------------------------
1fc6A4          ----------------------------------------------------------------------
1u37A1          ----------------------------------------------------------------------
1n99A1          ----------------------------------------------------------------------
1he1A           ----------------------------------------------------------------------
1u39A1          ----------------------------------------------------------------------
1vaeA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXFFISADGYAVTNNHVVDGADKVEVTTDDGKTYKAKVIGTDQRTDLALIKAEGRTDFPFAKLSEGK
2bhgA1          -----TGVFGTAYLVPRHLFAEKYDKIXLSDYRVFEFEIKVKGQDXLSDAALXVLHRGNKVRDITKDTAR
1ky9A2          ALGSGVIIDADGYVVTNNHVVDNATVIKVQLSDGRKFDAKXVGKDPRSDIALIQIQNPKNLTAIKXADSA
1mbmA           -----WTRNNEVVVLTASHVVGRANMATLKIGDAMLTLTFKKNGDFAEAVTTQSELPGNWPQL-HFAQPT
1lvbA           -----YGIGFGPFIITNKHLFRRNN---GTLLVQSLHGVFKVKNTTTLQQHLIDGRDXIDFPPFKLKFRE
1nf3C           ----------------------------------------------------------------------
1befA           ----------EGTFHTMWHVTRGAVLM----HKGKRIEP--SWADVKKDLVSCGGGWKL--------EGE
1ogsA1          -----CNATYCDSFDPPTFPALGTFSRYESTRSGRRMELPIQANHTGTGLLLTLQPEQKFQKQRVGLVAS
1ky9A1          ----------------------------------------------------------------------
1ep5A           -------------------MKLESDKTFPIMLEGKINGYACVVGGKLFRPMHVENDVLAALKTKKASKYD
1q3oA           ----------------------------------------------------------------------
1t16A           -----RAYSGEGAIADDAGNVSRNPAL-ITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAW
1qy6A           ------VVVGKDTLLTNKHVVDATHGDQDNYPNGGFTAEQITKYSGEGDLAIVKFSGEVVKPATMSNNAE
2i4sA1          ----------------------------------------------------------------------
1m5q1           -------------------------EVQVVLSNGEVYKGVLHAVDNQLNIVLANASNKAGEKFNRVFIXY
1lcyA1          ----------------------------------------------------------------------
1rzxA           ----------------------------------------------------------------------
1v62A           ----------------------------------------------------------------------
1y8tA1          ----------------------------------------------------------------------
1ky9B2          ----------------------------------------------------------------------
1x5nA1          ----------------------------------------------------------------------
2cs5A1          ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
1k32A1          ----------------------------------------------------------------------
2hgaA1          ----------------------------------------------------------------------
1sotA1          ----------------------------------------------------------------------
1wifA           ----------------------------------------------------------------------
1fc6A3          ----------------------------------------------------------------------
1qauA           ----------------------------------------------------------------------
1n99A2          ----------------------------------------------------------------------
1m5zA           ----------------------------------------------------------------------
1agjA           ----------------------------------------------------------------------
2f5yA1          ----------------------------------------------------------------------
1fc6A4          ----------------------------------------------------------------------
1ihjA           ----------------------------------------------------------------------
1u37A1          ----------------------------------------------------------------------
1n99A1          ----------------------------------------------------------------------
1kwaA           ----------------------------------------------------------------------
1sozC1          ----------------------------------------------------------------------
1n7eA           ----------------------------------------------------------------------
1he1A           ----------------------------------------------------------------------
1v6bA           ----------------------------------------------------------------------
1j7xA           ----------------------------------------------------------------------
1u39A1          ----------------------------------------------------------------------
1vaeA           ----------------------------------------------------------------------
1p3cA           ------TLIAPNKILTNGHCVYNTAKGSVTAVNGSANMTEFYTGASQYDFAVIKTDTNIGVGYRSIRQVT
1a1r.1          ----------------------------------------------------------------------
1nf3C           ----------------------------------------------------------------------
1ky9A1          ----------------------------------------------------------------------
1q3oA           ----------------------------------------------------------------------
2i4sA1          ----------------------------------------------------------------------
1lcyA1          ----------------------------------------------------------------------
1rzxA           ----------------------------------------------------------------------
1y8tA1          ----------------------------------------------------------------------
1ky9B2          ----------------------------------------------------------------------
1x5nA1          ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
1k32A1          ----------------------------------------------------------------------
2hgaA1          ----------------------------------------------------------------------
1sotA1          ----------------------------------------------------------------------
1qauA           ----------------------------------------------------------------------
1n99A2          ----------------------------------------------------------------------
1m5zA           ----------------------------------------------------------------------
2f5yA1          ----------------------------------------------------------------------
1fc6A4          ----------------------------------------------------------------------
1u37A1          ----------------------------------------------------------------------
1n99A1          ----------------------------------------------------------------------
1he1A           ----------------------------------------------------------------------
1u39A1          ----------------------------------------------------------------------
1vaeA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PRIGDWVLAVGNPFGLGGTVTAGIVSASGRDIGNGPYDDFIQIDAPVNKGNSGGPAFDTNGEVMGVNTAI
2bhgA1          XKKGTPVVGVVNNADVGRLIFSGEALTYKDIVVTXP--GLFAYKAATRAGYAGGAVLAKDGAIVGTHSA-
1ky9A2          LRVGDYTVAIGNPFGLGETVTSGIVSALGRSG----YENFIQTDAAINRGNAGGALVNLNGELIGINTAI
1mbmA           TGPASWCTATGDEEGLLSGEVCLAWTTSGDSGSAVVQGDAVVGVHTGSNTSGVAYVTTPSGKLLGADTVT
1lvbA           PQREERICLVTTNFQ---TKSXSSXVSDTSCTFPSSDGIFWKHWIQTKDGQAGSPLVSTRGFIVGIHSAS
1nf3C           ---------------------------------------------------------------------V
1befA           WKEGEEVVLALEPGKNPRAVKPGLFKTNAGT--------IGAVSLDFSPGTSGSPIIDKKGKVVGIYGNG
1ogsA1          QKNDLDAVALMHPDG---SAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWH-----------
1ky9A1          ----------------------------------------------------------------------
1ep5A           LEYADVPQNMRADTKYTHEKPQGYYSWHHGAV-QYENGRFTVPKGVGAKGDSGRPILDNQGRVVAIVLGG
1q3oA           ----------------------------------------------------------------------
1t16A           VPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNNLSGAYRLNNAWSFGLGFNAV
1qy6A           TQTNQNITVTGYP---GDKPVATMWESKGKITYLKGE--AMQYDLSTTGGNSGSPVFNEKNEVIGIHWGV
2i4sA1          ----------------------------------------------------------------------
1m5q1           RHIDSTERRIDXREFAKQAEIFPGXVKYIEE--TNVVLIGDKVRVSEIGVEGVGPVAERAKRLF------
1lcyA1          ----------------------------------------------------------------------
1rzxA           ----------------------------------------------------------------------
1v62A           ----------------------------------------------------------------------
1y8tA1          ----------------------------------------------------------------------
1ky9B2          ----------------------------------------------------------------------
1x5nA1          ----------------------------------------------------------------------
2cs5A1          ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
1k32A1          ----------------------------------------------------------------------
2hgaA1          ----------------------------------------------------------------------
1sotA1          ----------------------------------------------------------------------
1wifA           ----------------------------------------------------------------------
1fc6A3          ----------------------------------------------------------------------
1qauA           ----------------------------------------------------------------------
1n99A2          ----------------------------------------------------------------------
1m5zA           ----------------------------------------------------------------------
1agjA           LKDGDKLELIGYPFDHKVNQMHRS------EIELTTLSRGLRYYGFTVPGNSGSGIFNSNGELVGIHSSK
2f5yA1          ----------------------------------------------------------------------
1fc6A4          ----------------------------------------------------------------------
1ihjA           ----------------------------------------------------------------------
1u37A1          ----------------------------------------------------------------------
1n99A1          ----------------------------------------------------------------------
1kwaA           ----------------------------------------------------------------------
1sozC1          ----------------------------------------------------------------------
1n7eA           ----------------------------------------------------------------------
1he1A           ----------------------------------------------------------------------
1v6bA           ----------------------------------------------------------------------
1j7xA           ----------------------------------------------------------------------
1u39A1          ----------------------------------------------------------------------
1vaeA           ----------------------------------------------------------------------
1p3cA           NLTGTTIKISGYPGDSTGKVSQWEMSGSVTREDT----NLAYYTIDTFSGNSGSAMLDQNQQIVGVHNAG
1a1r.1          ------------------------------------------------KGSSGGPLLCPTGHAVGLFRAA
1nf3C           ----------------------------------------------------------------------
1ky9A1          ----------------------------------------------------------------------
1q3oA           ----------------------------------------------------------------------
2i4sA1          ----------------------------------------------------------------------
1lcyA1          ----------------------------------------------------------------------
1rzxA           ----------------------------------------------------------------------
1y8tA1          ----------------------------------------------------------------------
1ky9B2          ----------------------------------------------------------------------
1x5nA1          ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
1k32A1          ----------------------------------------------------------------------
2hgaA1          ----------------------------------------------------------------------
1sotA1          ----------------------------------------------------------------------
1qauA           ----------------------------------------------------------------------
1n99A2          ----------------------------------------------------------------------
1m5zA           ----------------------------------------------------------------------
2f5yA1          ----------------------------------------------------------------------
1fc6A4          ----------------------------------------------------------------------
1u37A1          ----------------------------------------------------------------------
1n99A1          ----------------------------------------------------------------------
1he1A           ----------------------------------------------------------------------
1u39A1          ----------------------------------------------------------------------
1vaeA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YSPSGGSVGIAFSIPASTVKTVVQQLKDKGSVSRGWIGVQIQPVTPEIADSLGLKKPDGALVAEPQPNGP
2bhgA1          -----GGNGVGYCSCVS--RSXLQKXK-------------------------------------------
1ky9A2          LAPDGGNIGIGFAIPSNXVKNLTSQXVEYG----------------------------------------
1mbmA           LSSSKHFTGPLTSIPKDIPDNIIADVDAVPRSLAMLIDG-------------------------------
1lvbA           NFTNTNNYFTS--VPKNFXELLTNQ--EAQQWVSGW----------------------------------
1nf3C           ISMPQDFRPVSSIIDVDILPETHRRVRLCKYGTEKPLGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGL
1befA           VV-TRSGAYVSAIAQTEKSIEDNPEIED------------------------------------------
1ogsA1          ----------------------------------------------------------------------
1ky9A1          -------------------------------VKRGELGIXGTELNSELAKAXKVDAQRGAFVSQVLPNSS
1ep5A           ---VNEGSRTALSVVMWNEKGVTVKYTPENCE--QW----------------------------------
1q3oA           ------------------IKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGV
1t16A           YARAKIERFAGDLGQLVAGQIM------------------------------------------------
1qy6A           PNEFNGAVFINENVR-------------------------------------------------------
2i4sA1          ---------------------------DKVDAIREAIARNPQEIFQYVRLSQVKRKVLGYRVSPGKDPVL
1m5q1           ----------------------------------------------------------------------
1lcyA1          ---------------------------------RRYIGVMMLTLSPSILAELQLRVQHGVLIHKVILGSP
1rzxA           ---------------------THRRVRLLKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFISRLVPGGL
1v62A           --------GSSGSSGDTVANASGPLMVEIVKTPGSALGISLTTTSLR--------NKSVITIDRIKPASV
1y8tA1          --------------------------------SHASLGVQVTN----------DKDTLGAKIVEVVAGGA
1ky9B2          ----------------------------------------------------NKGKDQGVVVNNVKTGTP
1x5nA1          --------------------------------GSRGLGCSISS---------GPIQKPGIFISHVKPGSL
2cs5A1          --------------------------------GIPHDNLVLIRMKPDENGRFGFNQKMPVIVSRVAPGTP
1be9A           ---------------------------------------------------IGGEDGEGIFISFILAGGP
1k32A1          ----------------------------------GRIACDFKLDG----DHYVVAKAYAGDYSNEGEKSP
2hgaA1          -------------------------------------------------------QPDGVQIDSVVPGSP
1sotA1          ----------------------------------------------------------GIVVNEVSPDGP
1wifA           -----------------------------------------------------IQNGPYLQISHLINKGA
1fc6A3          --------------------------------------------------------GKDVVVLTPAPGGP
1qauA           --------------------------------KVGGLGFLVK----------ERVSKPPVIISDLIRGGA
1n99A2          ----------------------------------------TITXHKDSTGHVGFI-FKNGKITSIVKDSS
1m5zA           --------------------------------GMEDFGFSVA----------DGLLEKGVYVKNIRPAGP
1agjA           VSHLDREHQINYGVGIGNY--VKRIINEKN----------------------------------------
2f5yA1          ---------------------------------------------------FTICCDSPVRVQAVDSGGP
1fc6A4          ---------------------EAWRAVDRAYVDKSFNGQSWFKL--------------RETYLKKEPXDR
1ihjA           --------------------------------GKKSFGICIVRGE---VKDSPNTKTTGIFIKGIVPDSP
1u37A1          -------------------------------QKGEILGV-------VIVESGWGSILPTVIIANMMHGGP
1n99A1          -------------------------------------------LCKDQDGKIGLRIDNGIFVQLVQANSP
1kwaA           -------------------------------------------FQKNTDEPMGITELNHCIVARIMHGGM
1sozC1          ----------------------------------------------------------------------
1n7eA           ----------------------------------------------------TEEPFDPIIISSLTKGGL
1he1A           ---------------------------------------------------------KASELATLTPEGL
1v6bA           --------------------------------KEGSLDLALEGGVDS--------PVGKVVVSAVYEGGA
1j7xA           -------------------------------------------------------------------RIP
1u39A1          ---------------------------------------------PDLRYQLGFSVQNG-IICSLMRGGI
1vaeA           -----------------------------------------------------------------DPHCS
1p3cA           YS--------------------------------------------------------------------
1a1r.1          VCTRGVAKAVDF-IPVENLETTM-----------------------------------------------
1nf3C           ----------------------------------------------------------------------
1ky9A1          ----------------------------------------------------------------------
1q3oA           ----------------------------------------------------------------------
2i4sA1          ----------------------------------------------------------------------
1lcyA1          ----------------------------------------------------------------------
1rzxA           ----------------------------------------------------------------------
1y8tA1          ----------------------------------------------------------------------
1ky9B2          ----------------------------------------------------------------------
1x5nA1          ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
1k32A1          ----------------------------------------------------------------------
2hgaA1          ----------------------------------------------------------------------
1sotA1          ----------------------------------------------------------------------
1qauA           ----------------------------------------------------------------------
1n99A2          ----------------------------------------------------------------------
1m5zA           ----------------------------------------------------------------------
2f5yA1          ----------------------------------------------------------------------
1fc6A4          ----------------------------------------------------------------------
1u37A1          ----------------------------------------------------------------------
1n99A1          ----------------------------------------------------------------------
1he1A           ----------------------------------------------------------------------
1u39A1          ----------------------------------------------------------------------
1vaeA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AAKAGIESGDVITAVNGTPVKDARELARTIGGFAPGNTVKLTVVHKGADRELNLTLGQLPNxxxxxxxxx
2bhgA1          ----------------------------------------------------------------------
1ky9A2          ----------------------------------------------------------------------
1mbmA           ----------------------------------------------------------------------
1lvbA           ----------------------------------------------------------------------
1nf3C           AQSTGLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPAN-----------------------
1befA           ----------------------------------------------------------------------
1ogsA1          ----------------------------------------------------------------------
1ky9A1          AAKAGIKAGDVITSLNGKPISSFAALRAQVGTXPVGSKLTLGLLRDGKQVNVNL----------------
1ep5A           ----------------------------------------------------------------------
1q3oA           AWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVT-----------------------
1t16A           ----------------------------------------------------------------------
1qy6A           ----------------------------------------------------------------------
2i4sA1          FESIGLQDGDXAVALNGLDLTDPNVXNTLFQSXNEXTEXSLTVERDGQQHDVYIQF--------------
1m5q1           ----------------------------------------------------------------------
1lcyA1          AHRAGLRPGDVILAIGEQMVQNAEDVYEAV---RTQSQLAVQIRRGRETLTLYVTP--------------
1rzxA           AESTGLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITVKPA------------------------
1v62A           VDRSALHPGDHILSIDGTSMEHCSLLEATKLLASISEKVRLEIL--------------------------
1y8tA1          AANAGVPKGVVVTKVDDRPINSADALVAAVRSKAPGATVALTFQDSGGSRTVQVTLGK------------
1ky9B2          AAQIGLKKGDVIIGANQQAVKNIAELRKVLD--SKPSVLALNIQRGDSTIYL------------------
1x5nA1          SAEVGLEIGDQIVEVNGVDFSNLDHKEAVNVLKSSRSLTISIVAAAGRELFMTD----------------
2cs5A1          ADLCRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLLVRPNAVYDVVEE------------
1be9A           ADLSGLRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVN----------
1k32A1          IFEYGIPTGYLIEDIDGETVGAGSNIYRVLSE-KAGTSARIRLSGKGGDKRDLMID--------------
2hgaA1          AS-KVLTPGLVIESINGMPTSNLTTYSAALKTISVGEVINITTDQGTFHLKTGRNPNNSS----------
1sotA1          AANAGIQVNDLIISVDNKPAISALETXDQVAEIRPGSVIPVVV---------------------------
1wifA           AASDGLQPGDVLISVGHANVLGYTEFLKLLQNITIGTVLQIKAYRGFLEIPQEWQDSGPSS---------
1fc6A3          AEKAGARAGDVIVTVDGTAVKGXSDVSDLLQG-EADSQVEVVLHAPGAPSN-------------------
1qauA           AEQSGIQAGDIILAVNDRPLVDLSDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTG----------
1n99A2          AARNGLLTEHNICEINGQNVIGL-----------------------------------------------
1m5zA           GDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR-------------------------
1agjA           ----------------------------------------------------------------------
2f5yA1          AERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVW--------------------------
1fc6A4          RAQTYDAIRKXLAVLDDPFTRFLPSRLAALRRGTKVTINPVTFTTCSN----------------------
1ihjA           AHLCGLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQ--------------------------
1u37A1          AEKSGLNIGDQIMSINGTSLVGLSTCQSIIKGLKNQSRVKLNI---------------------------
1n99A1          ASLVGLRFGDQVLQINGENCAGWSDKAHKVLKQAFGEKITXTIRDR------------------------
1kwaA           IHRQGLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSY-----------------------
1sozC1          --RGGIVVNDLIISVDNKPATM-----DQVAEIRPGSVIPLQVTIQE-----------------------
1n7eA           AERTGAIHGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQPAS-----------------
1he1A           AREHSRASGDGALRSLSTALAGIRSQVEESRI-QAGRLLERSIGGIALQQWGTTG---------------
1v6bA           AERHGVVKGDEIMAINGKIVTEAEAALQKAWN-QGGDWIDLVVAVCPPKYDDELTF--------------
1j7xA           TLLQHLPNLDYSTVISEEDIAELQSLTEDPRL-VLKSKTDTLVXPGDSIQAENIPE--------------
1u39A1          AERGGVRVGHRIIEINGQSVVATEKIVHILS--NAVGEIHMKTM--------------------------
1vaeA           ASLAGAKEGDYIVSIQGVDCKWVMKLLKSFG----GEEVEMKVV--------------------------
1p3cA           ----------------------------------------------------------------------
1a1r.1          ----------------------------------------------------------------------
1nf3C           ----------------------------------------------------------------------
1ky9A1          ----------------------------------------------------------------------
1q3oA           ----------------------------------------------------------------------
2i4sA1          ----------------------------------------------------------------------
1lcyA1          ----------------------------------------------------------------------
1rzxA           ----------------------------------------------------------------------
1y8tA1          ----------------------------------------------------------------------
1ky9B2          ----------------------------------------------------------------------
1x5nA1          ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
1k32A1          ----------------------------------------------------------------------
2hgaA1          ----------------------------------------------------------------------
1sotA1          ----------------------------------------------------------------------
1qauA           ----------------------------------------------------------------------
1n99A2          ----------------------------------------------------------------------
1m5zA           ----------------------------------------------------------------------
2f5yA1          ----------------------------------------------------------------------
1fc6A4          ----------------------------------------------------------------------
1u37A1          ----------------------------------------------------------------------
1n99A1          ----------------------------------------------------------------------
1he1A           ----------------------------------------------------------------------
1u39A1          ----------------------------------------------------------------------
1vaeA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxRGTEVPRLGLTVAPASSVAGAGKDGVVVTDVDPKSAAADRGFKEGDVILEVAGKNVASPGDV
2bhgA1          ----------------------------------------------------------------------
1ky9A2          ----------------------------------------------------------------------
1mbmA           ----------------------------------------------------------------------
1lvbA           ----------------------------------------------------------------------
1nf3C           ----------------------------------------------------------------------
1befA           ----------------------------------------------------------------------
1ogsA1          ----------------------------------------------------------------------
1ky9A1          ----------------------------------------------------------------------
1ep5A           ----------------------------------------------------------------------
1q3oA           ----------------------------------------------------------------------
1t16A           ----------------------------------------------------------------------
1qy6A           ----------------------------------------------------------------------
2i4sA1          ----------------------------------------------------------------------
1m5q1           ----------------------------------------------------------------------
1lcyA1          ----------------------------------------------------------------------
1rzxA           ----------------------------------------------------------------------
1v62A           ----------------------------------------------------------------------
1y8tA1          ----------------------------------------------------------------------
1ky9B2          ----------------------------------------------------------------------
1x5nA1          ----------------------------------------------------------------------
2cs5A1          ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
1k32A1          ----------------------------------------------------------------------
2hgaA1          ----------------------------------------------------------------------
1sotA1          ----------------------------------------------------------------------
1wifA           ----------------------------------------------------------------------
1fc6A3          ----------------------------------------------------------------------
1qauA           ----------------------------------------------------------------------
1n99A2          ----------------------------------------------------------------------
1m5zA           ----------------------------------------------------------------------
1agjA           ----------------------------------------------------------------------
2f5yA1          ----------------------------------------------------------------------
1fc6A4          ----------------------------------------------------------------------
1ihjA           ----------------------------------------------------------------------
1u37A1          ----------------------------------------------------------------------
1n99A1          ----------------------------------------------------------------------
1kwaA           ----------------------------------------------------------------------
1sozC1          ----------------------------------------------------------------------
1n7eA           ----------------------------------------------------------------------
1he1A           ----------------------------------------------------------------------
1v6bA           ----------------------------------------------------------------------
1j7xA           ----------------------------------------------------------------------
1u39A1          ----------------------------------------------------------------------
1vaeA           ----------------------------------------------------------------------
1p3cA           ----------------------------------------------------------------------
1a1r.1          ----------------------------------------------------------------------
1nf3C           ----------------DGSSVRVTPHGLEKVPGIFISRLVPGGLAQSTGLAVNDEVLEVNGIEVSGKSL-
1ky9A1          -------------GELGIXGTELNSELAKAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAAL
1q3oA           -----------------------------FPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHR
2i4sA1          -------------PQEIFQYVRLSQVKRDDKVGYRVSPGKDPVLFESIGLQDGDXAVALNGLDLTDPNVX
1lcyA1          -----------------------------VQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDV
1rzxA           ----------------DGTSVRVTASGLEKQPGIFISRLVPGGLAESTGLAVNDEVIEVNGIEVAGKTLD
1y8tA1          -------------ASLGVQVTNDKDTLGAK-----IVEVVAGGAAANAGVPKGVVVTKVDDRPINSADAL
1ky9B2          -----------------------------KDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAEL
1x5nA1          ---------------LGCSISSGPIQKP----GIFISHVKPGSLSAEVGLEIGDQIVEVNGVDFSNLDHK
1be9A           -------------------------IGGEDGEGIFISFILAGGPADLSGERKGDQILSVNGVDLRNASHE
1k32A1          -----------------------------------YSNEGEKSPIFEYGIDPGYLIEDIDGETVGAGSNI
2hgaA1          ------------------------------PDGVQIDSVVPGSPA-SKVLTPGLVIESINGMPTSNLTTY
1sotA1          ---------------------------GIGGRGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALET
1qauA           ---------------LGFLV-----KERVSKPPVIISDLIRGGAAEQSGLQAGDIILAVNDRPLVD-LSY
1n99A2          --------------------------------NGKITSIVKDSSAARNGLLTEHNICEINGQNVLKDSQI
1m5zA           ---------------FGFSV-----ADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCC
2f5yA1          -----------------------------CDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCV
1fc6A4          ---------------------------SWFKLRETYLKKEPXDRRAQTYDAIRKXLAVLDDPFTLEPSRL
1u37A1          ----------EKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGLNIGDQIMSINGTSLLPLSTC
1n99A1          -----------------------------IDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCWSSDKA
1he1A           --------QMVLQQALPMTL-------KGLDKASELATLTPEGLARHSRLASGDGALRSLSTAL-AGIRA
1u39A1          --------------------------------NGIICSLMRGGIAERGGVRVGHRIIEINGQSVTPHEKI
1vaeA           -----------------------------GNTPVQVHFLDPHCSASLAGAKEGDYIVSIQGVDCKW-LTV


                         *         .         .         .         .         +         .:560
query           REAINTAKADNKNSVLIRVRSGGSSRFVAVPISAKG
2bhgA1          ------------------------------------
1ky9A2          ------------------------------------
1mbmA           ------------------------------------
1lvbA           ------------------------------------
1nf3C           ------------------------------------
1befA           ------------------------------------
1ogsA1          ------------------------------------
1ky9A1          ------------------------------------
1ep5A           ------------------------------------
1q3oA           ------------------------------------
1t16A           ------------------------------------
1qy6A           ------------------------------------
2i4sA1          ------------------------------------
1m5q1           ------------------------------------
1lcyA1          ------------------------------------
1rzxA           ------------------------------------
1v62A           ------------------------------------
1y8tA1          ------------------------------------
1ky9B2          ------------------------------------
1x5nA1          ------------------------------------
2cs5A1          ------------------------------------
1be9A           ------------------------------------
1k32A1          ------------------------------------
2hgaA1          ------------------------------------
1sotA1          ------------------------------------
1wifA           ------------------------------------
1fc6A3          ------------------------------------
1qauA           ------------------------------------
1n99A2          ------------------------------------
1m5zA           ------------------------------------
1agjA           ------------------------------------
2f5yA1          ------------------------------------
1fc6A4          ------------------------------------
1ihjA           ------------------------------------
1u37A1          ------------------------------------
1n99A1          ------------------------------------
1kwaA           ------------------------------------
1sozC1          ------------------------------------
1n7eA           ------------------------------------
1he1A           ------------------------------------
1v6bA           ------------------------------------
1j7xA           ------------------------------------
1u39A1          ------------------------------------
1vaeA           ------------------------------------
1p3cA           ------------------------------------
1a1r.1          ------------------------------------
1nf3C           DQVTDMMIANSRNLIITVRPAN--------------
1ky9A1          RAQVGTXPVGSK--LTLGLLRDGKQVNVNL------
1q3oA           QVVNMIRQGGNTLMVKVV------------------
2i4sA1          NTLFQSXNEXTEXSLTVE------------------
1lcyA1          YEAVR-----TQSQLAVQIRRGRETLTLYV------
1rzxA           QVTDMMVANSSNLIITVK------------------
1y8tA1          VAAVRSKAPGATVALTFQDPSGGSRTVQVTLGKA--
1ky9B2          RKVLDSK----PSVLALNIQRGD-------------
1x5nA1          EAVNVLKSS--RSLTISIVAAAGRELFMTD------
1be9A           QAAIALKNA--GQTVTIIAQYKPEEYSRFEANSRVN
1k32A1          YRVL---SEKAGTSARIRLSGKGGDKRDLM------
2hgaA1          SAALKTISVGEV--INITTDQGTFHLKTGR------
1sotA1          XDQVAEIRP---------------------------
1qauA           DSALEVLRGIASETHVVLILRGPEGFTTHLETTF--
1n99A2          ADILSTS-----------------------------
1m5zA           LVVPLIAESGNKLDLVIS------------------
2f5yA1          ELAHEIRSCPSEIILLVW------------------
1fc6A4          AALRRGTKVTINPVTFTTCS----------------
1u37A1          QSIIKGLKNQSRVKLNIV------------------
1n99A1          HKVLKQAFGEKITXTIRD------------------
1he1A           GSQVEESRIQAGRLLERSIGGIALQQWGTTGGAA--
1u39A1          VHILSNAV----------------------------
1vaeA           SEVMKLLKSFGGEEVEMKVVS---------------