[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE39379.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1mwkA2.bssp"
#ERROR : Can't open dsspfile "1zd0A1.bssp"
#ERROR : Can't open dsspfile "1e6vB2.bssp"
#ERROR : Can't open dsspfile "1iwgA1.bssp"
#ERROR : Can't open dsspfile "1iwgA8.bssp"
#ERROR : Can't open dsspfile "1zruA3.bssp"
#ERROR : Can't open dsspfile "1iwgA2.bssp"
#ERROR : Can't open dsspfile "1iwgA7.bssp"
#ERROR : Can't open dsspfile "1iwgA5.bssp"
#ERROR : Can't open dsspfile "1iwgA4.bssp"
#ERROR : Can't open dsspfile "1iwgA6.bssp"
#ERROR : Can't open dsspfile "1iwgA3.bssp"
#ERROR : Can't open dsspfile "3dhwA1.bssp"
#ERROR : Can't open dsspfile "1iwgA8.bssp"
#ERROR : Can't open dsspfile "1iwgA7.bssp"
#ERROR : Can't open dsspfile "1iwgA4.bssp"
#ERROR : Can't open dsspfile "1iwgA6.bssp"

## Summary of PDB Search
:1070
    5e-35  16%  1mwkA2 [c.55.1.1] PARM A:158 -- 320
    5e-27  15%  1zd0A1 [d.329.1.1] HYPOTHETICAL PROTEIN PF0523 A:9 -- 144
    9e-25   8%  1e6vB2 [d.58.31.2] METHYL-COENZYME M REDUCTASE I BETA SUBUNIT B:7
    9e-24  32%  1iwgA1 [d.58.44.1] ACRB A:38 -- 134
    2e-22  23%  1iwgA8 [f.35.1.1] ACRB A:513 -- 566 A:869 -- 1036
    5e-22  13%  1zruA3 [b.163.1.2] LACTOPHAGE P2 RECEPTOR BINDING PROTEIN A:2 --
    8e-22  21%  1iwgA2 [d.58.44.1] ACRB A:135 -- 181 A:274 -- 330
    3e-21  23%  1iwgA7 [f.35.1.1] ACRB A:7 -- 37 A:331 -- 498
    1e-18  24%  1iwgA5 [d.225.1.1] ACRB A:182 -- 273
    2e-18  17%  1iwgA4 [d.58.44.1] ACRB A:674 -- 724 A:813 -- 859
    5e-15  15%  1iwgA6 [d.225.1.1] ACRB A:725 -- 812
    6e-15  13%  1iwgA3 [d.58.44.1] ACRB A:567 -- 673
    7e-04  28%  3dhwA1 [f.58.1.1] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN A:6
    3e-17   9%  1iwgA8 [f.35.1.1] ACRB A:513 -- 566 A:869 -- 1036(query 299->476)
    1e-14  14%  1iwgA7 [f.35.1.1] ACRB A:7 -- 37 A:331 -- 498(query 326->506)
    2e-04  12%  1iwgA4 [d.58.44.1] ACRB A:674 -- 724 A:813 -- 859(query 232->326)
    3e-10  17%  1iwgA6 [d.225.1.1] ACRB A:725 -- 812(query 193->275)
:1070

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIDAVPDITNVQVQINTNAPGYSPLEVEQRITFPIE
1mwkA2          ---------------------------------------------------------------GTTLDIS
1zd0A1          ----------------------------------------------------------------------
1e6vB2          -----------------------------------VDLYDDRGNCIEVLSPMRNEAIQSIVNDIKRTVAV
1iwgA1          -----------------------------------------IAPPAVTISASYPGADAKTVQDTVTQVIE
1iwgA8          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TAMGGLPNLVNTRSLSRYGLSQVTVVFKDGTDIYFARQLVNERVQRVKDILPVGIETAMGPVSTGLGEIY
1mwkA2          QVMGKLSGISKIYGDSSLGVSLVTSAVKDALSL----ARTKGSSYLADDIIIHRKDNNYLKQRINDENKI
1zd0A1          ----------------------------------------------------------------------
1e6vB2          D-LEGIENA------LQNATVGGKGMKIPGREMDVDIVDNAEAIADEIEKMIRVYQD-DDTNVEPMYDGK
1iwgA1          QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQ--------------
1iwgA8          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           MYTVEAKEGAKNAEGKPYTPSDLRTAQDWIIKPQLRNVAGVNEVNTIGGFEKQFHVLPDPARLMAYRLSF
1mwkA2          SIVT-------------EAMNEALRKLEQRVLNTLNEFSGYTHVMVIGGGAECDAVKKHTQIRDERFFKT
1zd0A1          ---------------------------------EIRTKVGEICISKVWLTDEQINKLFDRFKGDYQVVNA
1e6vB2          RLLV---------QLPSERVKVMADPYSGTLQAGMAVVHAIIDVCEVDMWDANMVKAAVFGRYPQTIDYF
1iwgA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1zruA3          --------------GMDYRTIRRKDWSSPL-NTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHA
1iwgA2          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA5          ------------------------------------------------------RIWMNPNELNKFQLTP
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------QFKIDIDQEKAQALGVSI


                         .         .         .         +         .         .         .:280
query           RDVMTSLASNNANVGAGYIEKNGEQYLVRTPGQVANVEDIRQIVIGSRNGVPVRIMDVAEVKEGTDLRTG
1mwkA2          NNSQYDLVNGMYLIG-------------------------------------------------------
1zd0A1          ECADKVIFAKAVKEGRSIAKTVPGEILVRLSGNRQIKEAIKKVGAKGENYIVTFGENA-----SALLQKI
1e6vB2          GGNVASMLDVPMKQE-------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1zruA3          NID----LTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGV-------------------
1iwgA2          ------------------------VVGVINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGQNYDI
1iwgA7          ----------------------------------------------------------------------
1iwgA5          VDVITAIKAQNAQVAAGQLKGQQLNASIIAQTRLTSTEEFGKILLKVQDGSRVLLRDVAKIELG------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA4          ---------------------TGFDFELIDLGHEKLTQARNQLLAEAAKHPMLTSVRPNGLEDTSPRGLP
1iwgA6          NDINTTLGAAWGGSYVNDFIDRGRVKKVYEAKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEY-----


                         .         *         .         .         .         .         +:350
query           AATVSGKEVVLGTAMLLIGENGRTVAQRVAAKLEQIQKSLPEGISLRAIYDRTHLIDATIATVEKNLIEG
1mwkA2          ----------------------------------------------------------------------
1zd0A1          LSTLEIKEL-------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1iwgA2          IAEFNGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDTT-----------------
1iwgA7          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
1iwgA8          ------------------YTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPDSGNQAPSLYAIS
1iwgA7          ---------------------------------------------LPVAQYPTPFVKISIHEVVKTLVEA
1iwgA4          SMEILGQAA-----------PGKSTGEAMEL-MEQLASKLPTGVGY------------------------
1iwgA6          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           XXXXXXXXXXXXGNIKAAFATALVIPLSMLFTITGMFENKVSANLMSLGXXXXXXXXXXXXXXXENCLRL
1mwkA2          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
1iwgA8          LIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQV-----GLLTTIGLSAKNAILI
1iwgA7          IILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDA-------I
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LAHEQQRRGRLLTREERFETIIAGAREVIKPSLFGTLIIAVVYLPVLTLTGVEGKMFTPMAXXXXXXXXX
1mwkA2          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
1iwgA8          VEFAKDLMDK--EGKGLIEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGA--------------
1iwgA7          VVVENVERVMAEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMAL
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           XXXXXXXFVPAAVALMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1mwkA2          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA7          SVLVALILTPALCATM------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxDEGDVAIQAMRIPGTSLTQSLEMQMALEKRLLAIPEVKEAFARTGTAEVATDPMPPSISDGYVM
1mwkA2          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA3          ------DQGVFMTMVQLPAGATQERTQKVLNEVTHYYLTKNNVESVFAVNGFGFAGRGQ---NTGIAFVS
3dhwA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           LKPRDQWPDPKKPKLEVMKEIETASEEVAGNLYELSQPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1mwkA2          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA3          LKDWADRPGEENKVEAITMRATRAFSQIKDAMVFAFNL--------------------------------
3dhwA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxPVLTVKLDRQALARFGINVADVQSLVEIAVGGKSAGLVFEGDRRFD
1mwkA2          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA4          ---------------------------------------------------------------ATGFDFE
1iwgA6          ------------------------PQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
1iwgA3          ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LVVRLPDHLRTDVEAIKRLPIPLPPADGQAKATPAVFGNSPLAQMRYAPLAELAEISVSPGPNQISREDG
1mwkA2          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA4          LIDQAGLGHEKLTQARNQLLAEA--AKHP-----------------MLTSVRPN--GLEDTSPRLERYNG
1iwgA6          VYVMSEAKYRMLPDDIGDWYVRAA-------------------DGQMVPFSAFSSSRWEYG---------
1iwgA3          ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           KRRIVVSANVRGRDLGSFVGEAQQLVAGKVKLPAGYWIGWGGQFEQLVSATERLTIVVPXXXXXXXXXXX
1mwkA2          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA8          -RMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRPSSFLPDSGNQAPSLYAISLIVVFLCLA
1zruA3          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA4          LPSMEILGQAAGKSTGEAMELMEQLAS---KLPTGVGYDW------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           XXXXXXXDALLVFSGVPLALTGGIFALLLRGIPLSISAGIGFIALSGVAVLNGLVIITFIERLRGDGRKI
1mwkA2          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA8          ALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDKEGKL
1zruA3          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA7          --------TLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMAEEGLP
1iwgA5          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
3dhwA1          ----------VWMIPFTRVIVGTSIGLQAAIVPLTVG-AAPFIARMVENALLE-IPTGLIEASRAMGATP
1iwgA8          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           VDAVREGALTRLRPVLMTALVASLGFVPMALATGAGAEVQRPLATVVIGGIVSSTILTLLVLPALYILFR
1mwkA2          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA8          IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQNAVGTGVMGGMVTATVLAIFFVPVFFVVVR
1zruA3          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA7          PEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATML
1iwgA5          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
3dhwA1          MQIVRKVLLPEALPGLVNAATITLGYSAMGGAVGAGGLGQIGYQYGYIGATVMNTVLVLLVILVYLIQF-
1iwgA8          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           REASxxxxxxxxxxxxxxxx
1mwkA2          --------------------
1zd0A1          --------------------
1e6vB2          --------------------
1iwgA1          --------------------
1iwgA8          RRFS----------------
1zruA3          --------------------
1iwgA2          --------------------
1iwgA7          K-------------------
1iwgA5          --------------------
1iwgA4          --------------------
1iwgA6          --------------------
1iwgA3          --------------------
3dhwA1          --------------------
1iwgA8          --------------------
1iwgA7          --------------------
1iwgA4          --------------------
1iwgA6          --------------------