[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE39396.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1fviA2.bssp"
#ERROR : Can't open dsspfile "1x9nA3.bssp"
#ERROR : Can't open dsspfile "1b04A.bssp"
#ERROR : Can't open dsspfile "1a0iA1.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1fviA1.bssp"
#ERROR : Can't open dsspfile "1ckmA2.bssp"

## Summary of PDB Search
:313
    1e-24  13%  1fviA2 [d.142.2.1] CHLORELLA VIRUS DNA LIGASE-ADENYLATE A:2 -- 189
    3e-20  23%  1x9nA3 [d.142.2.1] DNA LIGASE I A:534 -- 753
    6e-14  14%  1b04A  [d.142.2.2] PROTEIN (DNA LIGASE)
    2e-10  17%  1a0iA1 [b.40.4.6] DNA LIGASE A:241 -- 349
    1e-06   9%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    1e-05  18%  1fviA1 [b.40.4.6] CHLORELLA VIRUS DNA LIGASE-ADENYLATE A:190 -- 293
    7e-04  22%  1ckmA2 [d.142.2.3] MRNA CAPPING ENZYME A:11 -- 238
:313

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxFVQPQLATLRTRPPSGAGWIHEIKLDGYRGQAHVGPQGTRIYTRGGHD
1fviA2          ----------------------ITKPLLAATLENIEDVQFCLATPKIAGIRSVKQT-----QMLSRTFKP
1x9nA3          -----------------------LKPXLAHPTRGRFEEAAFTCEYKYDGQRAQIHLEGGEVKIFSRNQED
1b04A           ---------------------------------QEVGEAAYVCELAIDGLAVSVRYDGYFVQGATRGGED
1a0iA1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1fviA1          ----------------------------------------------------------------------
1ckmA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           WSKMFAPLVAALSDAAXXXXXXXXXXXXXXXXRTDFGXXXXXXXXXXXXXMLFYAFDLLHLDGYDLGPVP
1fviA2          IRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHAK--------FSYYWFDYVTDDPLKKYIDR
1x9nA3          NTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKELYAFDLIYLNGESLVREP
1b04A           ITENLKTIRSLP--LRLKEPVSLEARGEAFMPKASFLRLNEERKARELFANPLFVYGLADAEALG--IAS
1a0iA1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1fviA1          ----------------------------------------------------------------------
1ckmA2          ----------------------------------------------------FVLFDAVVVSGVTVSQMD


                         +         .         .         .         .         *         .:210
query           LTERKRLLKGLFDRGLEPPVVYSDSMDDGEAMFDGAGRLGWEGIVSKRADAPYRSGDRSLDWQKIKTSKR
1fviA2          VEDMKNYITVHPHILEHAQVVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLILLKMK----
1x9nA3          LSRRRQLLRENF-VETEGEFVFATSIEQIAEFLEQSVKDSCEGLXVKTLDATYEIAKRSHNWLKLK----
1b04A           HSEALDYLQALGFK-VNPERRRCANIDEVIADKRPQLPYEIDGIVIKVDSFAQQRAAKSPRW--------
1a0iA1          ---------------------------------------------------------------------E
2gtlM1          ---------------LNITHVGSSYTGATWTSCEDLNPDHAIVTITAAHRKSFFPNRVWTLSYELDEHDH
1fviA1          --------------------------------------------------------------------KD
1ckmA2          LASRKRSLKEFKNVPEDPAILPLEHPTIIKDHLKKANAIHTDGLIIMSVDEPVIYG--------------


                         .         .         .         +         .         .         .:280
query           EHLVIVGYVPATGGIAALHVARRDGDSLVYAGKVGTGFSVKVGADLRRRLAEIETXXXXXXXXXXXXXXX
1fviA2          ----------------------------------------------------------------------
1x9nA3          ----------------------------------------------------------------------
1b04A           ----------------------------------------------------------------------
1a0iA1          ADGIIQGLVWGTKGKVIGFEVLLESGRLVNATNISRALMDEFTETVKEATLSQWG--------FFDACTI
2gtlM1          TVSTTQLRGFYNFGKRELLLAPLKGQSYGVICDFNLGDDDHADCKIVVPS--------------------
1fviA1          AEATIISMTALFKDVMGSIEVDYDG----VVFSIGTGFDADQRRDFWQNKESYIGKM-------------
1ckmA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXXMSADVEYRDITASGHLRHASFKGLxxxx
1fviA2          ---------------------------------
1x9nA3          ---------------------------------
1b04A           ---------------------------------
1a0iA1          NPYDGWACQISYMEETPDGSLRHPSFVMF----
2gtlM1          ---------------------------------
1fviA1          -------VKFKYFEMP-----RFPVFIGI----
1ckmA2          ---------------------------------