[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE39446.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1pyfA.bssp"
#ERROR : Can't open dsspfile "1pz1A.bssp"
#ERROR : Can't open dsspfile "1og6A.bssp"
#ERROR : Can't open dsspfile "1a80A.bssp"
#ERROR : Can't open dsspfile "1exbA.bssp"
#ERROR : Can't open dsspfile "1gveA.bssp"
#ERROR : Can't open dsspfile "1lqaA.bssp"
#ERROR : Can't open dsspfile "2jokA1.bssp"
#ERROR : Can't open dsspfile "1d0nA6.bssp"
#ERROR : Can't open dsspfile "1m65A.bssp"
#ERROR : Can't open dsspfile "1chuA3.bssp"
#ERROR : Can't open dsspfile "1b9kA2.bssp"

## Summary of PDB Search
:281
    5e-53  29%  1pyfA  [c.1.7.1] IOLS PROTEIN
    9e-50  33%  1pz1A  [c.1.7.1] GENERAL STRESS PROTEIN 69
    7e-46  24%  1og6A  [c.1.7.1] HYPOTHETICAL OXIDOREDUCTASE YDHF
    2e-45  27%  1a80A  [c.1.7.1] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
    3e-40  25%  1exbA  [c.1.7.1] KV BETA2 PROTEIN
    3e-39  21%  1gveA  [c.1.7.1] AFLATOXIN B1 ALDEHYDE REDUCTASE
    4e-39  31%  1lqaA  [c.1.7.1] TAS PROTEIN
    9e-33  10%  2jokA1 [a.168.1.1] PUTATIVE G-NUCLEOTIDE EXCHANGE FACTOR A:78 --
    4e-23  12%  1d0nA6 [d.109.1.1] HORSE PLASMA GELSOLIN A:629 -- 755
    3e-20  15%  1m65A  [c.6.3.1] HYPOTHETICAL PROTEIN YCDX
    8e-19  15%  1chuA3 [d.168.1.1] PROTEIN (L-ASPARTATE OXIDASE) A:238 -- 353
    3e-16  11%  1b9kA2 [d.105.1.1] PROTEIN (ALPHA-ADAPTIN APPENDAGE DOMAIN) A:825
:281

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxTRRFGRGGPEIAPIGQGTWYIDRGDRTAAIAALRRGLDLGMTHIDTAEMYGDAEPLVAEAIDGRRD
1pyfA           ----KAKLGKSDLQVFPIGLGTNAVGGHNEETGKELVREAIRNGVTXLDTAYIYGRSEELIGEVLEFNRE
1pz1A           -----TSIADTGIEASRIGLGTWAIGGTDEKTSIETIRAALDQGITLIDTAPAYGFSEEIVGKAIKEKRD
1og6A           ----RITIAPQGPEFSRFVMGYWRLWNMSARQLVSFIEEHLDLGVTTVDHADIYYQCEAAFGEALKHLRE
1a80A           ----SIVLNDG-NSIPQLGYGVFKVPPAD---TQRAVEEALEVGYRHIDTAAIYGEGVGAAIAASGIARD
1exbA           -----RNLGKSGLRVSCLGLGTWFGGQITDEMAEHLMTLAYDNGINLFDTAEVYGKAEVVLGNIIKKKRS
1gveA           --------------RPATVLGAMEMRRMDVTSSSRSVRAFLQRGHTEIDTAFVYANSETILGDGLGRSGC
1lqaA           ----YHRIPHSSLEVSTLGLGTMTFEQNSEADAHAQLDYAVAQGINLIDVAEMYGLTETYVGNWLAKHGS
2jokA1          --------------------------------------------------------------DAKQAIRH
1d0nA6          ----------------------------------------DAHPPRLFACSNKIGRIEEVPGEFMQETDD
1m65A           ---------------------TVASTHAYSTLS-DYIAQAKQKGIKLFAITDHGMEDAPHHWHFINMRIW
1chuA3          ------------------------------------------LEFNQFHPTALYHPRNFLLTEALRGEGA
1b9kA2          ---------------------------------------------------PTEMASQDFFQRWKQNPQQ


                         .         .         *         .         .         .         .:140
query           EVFLVSKVLPSNASRSGAIAACERSLKRLKTDRLDCYLLHWRGKVRLADTVAAFEELVAAGKIRSWGVSN
1pyfA           DVVIATKAFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFDEHTPKDEAVNALNEXKKAGKIRSIGVSN
1pz1A           QVILATKTLFRHANRARIVEEVENSLKRLQTDYIDLYQVHWPPLVPIEETAEVXKELYDAGKIRAIGVSN
1og6A           RMEIVSKCGIATTDRDHIIKSAEQSLINLATDHLDLLLIHRPPLMDADEVADAFKHLHQSGKVRHFGVSN
1a80A           DLFITTKLWNDRHDGDEPAAAIAESLAKLALDQVDLYLVHWPAADNYVHAWEKMIELRAAGLTRSIGVSN
1exbA           SLVITTKIFERGLSRKHIIEGLKASLERLQLEYVDVVFANRDPNTPMEETVRAMTHVINQGMAMYWGTSR
1gveA           KVKIAAPMFGKTLKPADVRFQLETSLKRLQCPRVDLFYLHFPDGTPIEETLQACHQLHQEGKFVELGLSN
1lqaA           KLIIASKRPDQALDRKNIREALHDSLKRLQTDYLDLYQVHWAPAVSLLDTLDALAEYQRAGKIRYIGVSN
2jokA1          FVDEAVKQVAIRQDAEFGRQVYEATLCAIFSEAKDRFCMDPIEALGDAARATGLPGADKQGVFTPSGAGT
1d0nA6          VMLLDTWDQVFVWVGKDSQDEEKTEALTSAKRYIDTDPAHRDRRTPITVVKQGFEPPSFVGWFLGWDDSY
1m65A           PRVVDGVGILRGIEANIKNVDGEIDCSGKMFDSLDLIIAGFFAPHDKATNTQAMIATIASGNVHIISHPG
1chuA3          YLKRPDGTRGELAPRDIVARAIDHEMKRLGADCMFLDISHK-PADFIRQHFPMIYEKLLGEPVPIVPAAH
1b9kA2          EVQNIFKAKITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTRLTLRTSKDTVQRLCELLSEQ------


                         +         .         .         .         .         *         .:210
query           FDAGDLWELLKVAGPGRIACNQVLYHLRERAIEHAVVPWCEAHGVAVTAYSPFGHDEFPEPRSAEGRLLQ
1pyfA           FSLEQLKEANK---DGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPLVSGLLEDTTFPEGDLLA
1pz1A           FSIEQXDTFRAVA---PLHTIQPPYNLFEREXEESVLPYAKDNKITTLLYGSFQKPRFKEYLSAVNQLDK
1og6A           FTPAQFALLQSRLPF-TLATNQVEISPVHQPLLDGTLDQLQQLRVRPMAWSCLGLFNDDYFQPLRDELAV
1a80A           HLVPHLERIVAAT---GVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEP---VT
1exbA           WSSMEIMEAYSVANLIPPICEQAEYHMFQRKVEVQLPELFHKIGVGAMTWSPLACSEEGRRQQAKLKELQ
1gveA           YVSWEVAEICTLCGWIMPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGEEHFNGIALVEKALK
1lqaA           ETAFGVMRYLHLADLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFRYSGEQTQKAVAAYV
2jokA1          NPLIRLRADTLMGAELAARPEYRELQPYARQAIDLVANALPAERSNTLVEFRQTVQ-TLEATYRRAAQDA
1d0nA6          WSVDPLDRALAEL---------------------------------------------------------
1m65A           NPK---YEIDVKAVAEAAAKHQVALEINNSSNCREVAAAVRDAGGWVALGSDSHTAFTMGEFEE----CL
1chuA3          Y---------------------------------------------------------------------
1b9kA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AIAGAHGATPRQVALAFLTRRPSLFAIPKXXXXXXXXXXXXXXSLRLSDEEIAAIDQAFPLGPEPAxxxx
1pyfA           PIAEKHNVDIPHIVLAWYLARPEIILIPGAKRADQLIDNIKTADVTLSQEDISFIDKLFAPG--------
1pz1A           LAKTRYGKSVIHLAVRWILDQPGAIALWGARKPGQLEALSEITGWTLNSEDQKDINTILPVGPE------
1og6A           VAEELNAGSIEQVVNAWVLRLPSQPLPIGSGKIERVRAAVEAETLKMTRQQWFRIRKA------------
1a80A           AAAAAHGKTPAQAVLRWHLQKGF-VVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDPGDGSGR----
1exbA           AIAERLGCTLPQLAIAWCLRNEGVSVLLGASNAEQLMENIGAIQVKLSSSIVHEIDSIL-----------
1gveA           TTYGPTAPSMISAAVRWMYHHSQLAVILGMSSLEQLEQNLALVEEPLEPAVVDAFDQAWNLVAHEC----
1lqaA           DIARRHGLDPAQMALAFVRRQPFVASLLGATTMDQLKTNIESLHLELSEDVLAEIEAVHQVYTYPA----
2jokA1          SRDEKGATNAADGA--------------------------------------------------------
1d0nA6          ----------------------------------------------------------------------
1m65A           KILDAVDFPPERILLNFLESRG-MAPIAE-----------------------------------------
1chuA3          ----------------------------------------------------------------------
1b9kA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           x
1pyfA           -
1pz1A           -
1og6A           -
1a80A           -
1exbA           -
1gveA           -
1lqaA           -
2jokA1          -
1d0nA6          -
1m65A           -
1chuA3          -
1b9kA2          -