[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE39477.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1zkiA1.bssp"
#ERROR : Can't open dsspfile "1o0iA.bssp"
#ERROR : Can't open dsspfile "1q4sA.bssp"
#ERROR : Can't open dsspfile "2hboA1.bssp"
#ERROR : Can't open dsspfile "1sh8A.bssp"
#ERROR : Can't open dsspfile "1j1yA.bssp"
#ERROR : Can't open dsspfile "2cy9A1.bssp"
#ERROR : Can't open dsspfile "2f3xA1.bssp"
#ERROR : Can't open dsspfile "1tbuA1.bssp"
#ERROR : Can't open dsspfile "1yocA1.bssp"
#ERROR : Can't open dsspfile "2ownA2.bssp"
#ERROR : Can't open dsspfile "1c8uA1.bssp"
#ERROR : Can't open dsspfile "2nujA1.bssp"
#ERROR : Can't open dsspfile "1vpmA.bssp"
#ERROR : Can't open dsspfile "1z54A1.bssp"
#ERROR : Can't open dsspfile "2ov9A1.bssp"
#ERROR : Can't open dsspfile "2av9A1.bssp"
#ERROR : Can't open dsspfile "1s5uA.bssp"
#ERROR : Can't open dsspfile "2gvhA2.bssp"
#ERROR : Can't open dsspfile "2aliA1.bssp"
#ERROR : Can't open dsspfile "1bvqA.bssp"
#ERROR : Can't open dsspfile "1z6bA1.bssp"
#ERROR : Can't open dsspfile "2ownA1.bssp"
#ERROR : Can't open dsspfile "1iq6A.bssp"
#ERROR : Can't open dsspfile "1yliA1.bssp"
#ERROR : Can't open dsspfile "2essA2.bssp"
#ERROR : Can't open dsspfile "1ixlA.bssp"
#ERROR : Can't open dsspfile "1pn2A2.bssp"
#ERROR : Can't open dsspfile "2gf6A1.bssp"
#ERROR : Can't open dsspfile "1s9cA2.bssp"
#ERROR : Can't open dsspfile "2gvhA1.bssp"

## Summary of PDB Search
:152
    1e-19  26%  1zkiA1 [d.38.1.5] HYPOTHETICAL PROTEIN PA5202 A:4 -- 129
    4e-17  17%  1o0iA  [d.38.1.5] HYPOTHETICAL PROTEIN HI1161
    3e-16  21%  1q4sA  [d.38.1.5] THIOESTERASE
    5e-16  22%  2hboA1 [d.38.1.5] HYPOTHETICAL PROTEIN (NP_422103.1) A:12 -- 153
    1e-13  17%  1sh8A  [d.38.1.5] HYPOTHETICAL PROTEIN PA5026
    3e-13  28%  1j1yA  [d.38.1.5] PAAI PROTEIN
    9e-13  21%  2cy9A1 [d.38.1.5] THIOESTERASE SUPERFAMILY MEMBER 2 A:13 -- 139
    2e-12  15%  2f3xA1 [d.38.1.5] TRANSCRIPTION FACTOR FAPR A:66 -- 186
    9e-12  14%  1tbuA1 [d.38.1.3] PEROXISOMAL ACYL-COENZYME A THIOESTER HYDROLASE
    2e-11  19%  1yocA1 [d.38.1.5] HYPOTHETICAL PROTEIN PA1835 A:1 -- 145
    3e-11  13%  2ownA2 [d.38.1.8] PUTATIVE OLEOYL-[ACYL-CARRIER PROTEIN] A:150 --
    6e-11  17%  1c8uA1 [d.38.1.3] ACYL-COA THIOESTERASE II A:2 -- 115
    9e-11  15%  2nujA1 [d.38.1.1] THIOESTERASE SUPERFAMILY A:3 -- 161
    1e-10  18%  1vpmA  [d.38.1.1] ACYL-COA HYDROLASE
    5e-10  19%  1z54A1 [d.38.1.1] PROBABLE THIOESTERASE A:1 -- 132
    1e-09  21%  2ov9A1 [d.38.1.5] HYPOTHETICAL PROTEIN A:7 -- 209
    2e-09  17%  2av9A1 [d.38.1.1] THIOESTERASE A:5 -- 146
    3e-09  10%  1s5uA  [d.38.1.1] PROTEIN YBGC
    5e-09  18%  2gvhA2 [d.38.1.1] AGR_L_2016P A:147 -- 262
    1e-08  12%  2aliA1 [d.38.1.1] HYPOTHETICAL PROTEIN PA2801 A:5 -- 134
    3e-08  16%  1bvqA  [d.38.1.1] PROTEIN (4-HYDROXYBENZOYL COA THIOESTERASE)
    7e-08  14%  1z6bA1 [d.38.1.6] FATTY ACID SYNTHESIS PROTEIN A:84 -- 229
    1e-07  12%  2ownA1 [d.38.1.8] PUTATIVE OLEOYL-[ACYL-CARRIER PROTEIN] A:3 -- 149
    2e-05  16%  1iq6A  [d.38.1.4] (R)-SPECIFIC ENOYL-COA HYDRATASE
    4e-05  28%  1yliA1 [d.38.1.1] PUTATIVE ACYL-COA THIOESTER HYDROLASE HI0827
    5e-05  12%  2essA2 [d.38.1.8] ACYL-ACP THIOESTERASE A:150 -- 247
    5e-05  22%  1ixlA  [d.38.1.5] HYPOTHETICAL PROTEIN PH1136
    1e-04   9%  1pn2A2 [d.38.1.4] PEROXISOMAL HYDRATASE-DEHYDROGENASE-EPIMERASE
    1e-04  12%  2gf6A1 [d.38.1.1] CONSERVED HYPOTHETICAL PROTEIN A:1 -- 134
    4e-04  10%  1s9cA2 [d.38.1.4] PEROXISOMAL MULTIFUNCTIONAL ENZYME TYPE 2 A:10 --
    4e-04  20%  2gvhA1 [d.38.1.1] AGR_L_2016P A:9 -- 143
:152

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDRESVFWKIADGRLPPPPCAETLGIEFLRVTPESGSIEVKFEATSAFLNLAGNVQGGFLAAMLDDTMGP
1zkiA1          ------------------AYSELVGLDPVSLGD--GVAEVRLPXAAHLRNRGGVXHGGALFSLXDVTXGL
1o0iA           -------------QLCSNSAVSHLGIEISAFGE--DWIEATXPVDHRTXQPFGVLHGGVSVALAETIGSL
1q4sA           ------------PVAYEQTLDGTVGFVIDEMTP--ERATASVEVTDTLRQRWGLVHGGAYCALAEMLATE
2hboA1          ---------------WSRGFGRQIGPLFEHR-EGPGQARLAFRVEEHHTNGLGNCHGGXLXSFADXAWGR
1sh8A           -----------------IAFVQRSGLRAEVLEPGYVRLRMPG---AGNENHIGSMYAGALFTLAELPGGA
1j1yA           -----------------DPFMEALGLKVLHLAP--GEAVVAGEVRADHLNLHGTAHGGFLYALADSAFAL
2cy9A1          ------------VXFKVPGFDVLEKVTLVSAAP--EKLICEXKVEEQHTNKLGTLHGGLTATLVDSISTX
2f3xA1          ------------------LSLDEVIGEIIDLELDDQAISILEIKQEHVFSRNQIARGHHLFAQAN-----
1tbuA1          -------------------------------------LELVPLSPTSFVTKYLPTFGGTLVSQSLLASL-
1yocA1          -----------------APYFASIAPQFVELRP--GYAEVTFPKRREVLNHIGTVHAIALCNAAELAAGT
2ownA2          -------------------------PISFEATD--TTITKPYHVRFFDIDPNRHVNNAHYFDWLVDTLPA
1c8uA1          -------------------------------------IEEGLFRGQSEDLGLRQVFGGQVVGQAL-----
2nujA1          --------------LPPTPLPAETLRALSIPAP--WTFGLADRVRFGELDAIGHVNHTAYLRWYESFRLP
1vpmA           ------------------------------YPVERSRTIQTRLVLPPDTNHLGTIFGGKVLAYIDEIAA-
1z54A1          ------------------------------------ESVTRIKVRYAETDQMGVVHHSVYAVYLEAARGL
2ov9A1          -------------PVTGPENALAPPVVLEGLSD--GSVRGTVTLTIPYQGPPGHVHGGVSALLLDHVLGV
2av9A1          -----------------------------RPLREQYLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNT
1s5uA           --------------------------------------RWPVRVYYEDTDAGGVVYHASYVAFYERARHF
2gvhA2          ------------------------------------AVTXVEIVFPDQANSAGRXFGGEAIAYXTKAAF-
2aliA1          --------------------------------------TAHIPVRWGDXDSYGHVNNTLYFQYLEEARVA
1bvqA           ------------------------------------SITMQQRIEFGDCDPAGIVWYPNYHRWLDAASRN
1z6bA1          IDIEDIK-KILPHRYPFLLVDKVIYMQPNKTIIGLKQVSTNEPFFNGHFPQKQIMPGVLQIEALAQLAGI
2ownA1          ---------------------------------NASLYSEQHRITYYECDRTGRATLTTLIDIAVLALGL
1iq6A           -------------------------------------------------FAATTAFERPIVGMLLASLFS
1yliA1          --------------------------------QSKGVLLLRTLAMPSDTNANGDIFGGWIMSQMD--MGG
2essA2          -----------------------------RIKVTSNQPVATLTAKYSDIDINGHVNSIRYIEHILDLFPI
1ixlA           --------------------SRILVGKPILIKE--GYAEVELETIDEKVDEKGLVHGGFTFGLADYAAXL
1pn2A2          -----------------------------------------------HIDPNFAKGAKFPKPILHGXCTY
2gf6A1          ----------------------------------------------------------------------
1s9cA2          ----------------------------------------------------------------------
2gvhA1          ----------------------------------GATTRLIDIVFPGDTNHHGTLFGGTGLALXDRVAF-


                         .         .         *         .         .         .         .:140
query           ALVATLGAGEFAPTVSLNVQFHRPARVGALKGIGRVLLRGKEVCQLSGELLQDDRVVATGTATAVIRRMG
1zkiA1          ACSSSHGFDRQSVTLECKINYIRAVADGEVRCVARVLHAGRRSLVVEAEVRQGDKLVAKGQGT-------
1o0iA           AGSLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIREENKLCCVSRLTLSVINL-
1q4sA           ATVAVVHEGMMAVGQSNHTSFFRPVKEGHVRAEAVRIHAGSTTWFWDVSLRDAGRLCAVSSMSIAVRP--
2hboA1          IISLQKSYS--WVTVRLXCDFLSGAKLGWVEGEGELISEEDXLFTVRGRIWAGERTLITGTGV-------
1sh8A           LFLTSFDSAFYPIVKEMTLRFRRPAKGDIRQLETEAGERGKAEYSLELQLTEQGEVVAESAALYQLRSHA
1j1yA           ASNTRGP----AVALSCRMDYFRPLGAGARVEARAVEVNSRRTATYRVEVVSEGKLVALFTGTVFR----
2cy9A1          ALXCTPGV-----SVDXNITYXSPAKIGEIVITAHILKQGKTLAFASVDLTNTGKLIAQGRHTKHL----
2f3xA1          SLAVAVIDDELALTASADIRFTRQVKQGVAKAKVTAVEKEKGRTVVEVNSYVGEEIVFSGRFDMYRSK--
1tbuA1          -----HTVPLNFFPTSLHSYFIKGGDPRKITYHVQNLRNGRNFIHKQVSAYQHDKLIFTSMILFAV----
1yocA1          MTDASIPAGHRWIPRGMTVEYLAKATGDRAVADGSQIWQATGNLVVPVVAYVDDKPVFRAEITMYVSQ--
2ownA2          T------FLLQHDLVHVDVRYENEVKYGTVTAHANILPSEVADQVTTSHLIVDDEKCCEVTIQWRTLP--
1c8uA1          -YAAKETVPEERLVHSFHSYFLRPGDSKKIIYDVETLRDGNSFSARRVAAIQNGKPIFYMTASFQAPE--
2nujA1          FLKARHVTSPRLVLKQVHCTYLAEXGXGEDYVIGRVSNFRTTSFTXEFACWRLGECTSEGSAVVVLLNRD
1vpmA           LTAXKHANSAVVTASIDSVDFKSSATVGALELEGFVTHTGRTSXEVYVRVHSNNTLTTESFLTXVAV---
1z54A1          PYHRVEARGVFFPVVELGLTFRAPARFGEVEVRTRLAELSSRALLFRYRVEREGVLLAEGFTRHLC----
2ov9A1          ANAWGG---KAGXTAQLSTRYHRPTPLFPLTLTGKLXSVDGRKITTAGDIRADGQVCVSVEGLFV-----
2av9A1          YLIERGGGEVIGLVVSSSCDYFAPVAFPRIEXGLRVARLGNSSVQYELALFGQREACAAGRFVHVFVERR
1s5uA           SQQALMAERVAFVVRKMTVEYYAPARLDMLEIQTEITSMRGTSLVFTQRIVAENTLLNEAEVLVVCVD--
2gvhA2          VAASRYCGKLVVLASSERIDFARAIEIGHVERVGRSSXSIQTKLWSENLLTGERHITATGHFTXVAVD--
2aliA1          WFETLEGAAEGPVVLQSLHTYLKPVVHPTVVVELYAGRLGTSSLVLEHRLHDPQGTYGEGHCKLVWVRHA
1bvqA           YFIKCGLGIVGTPIVSCNASFVCTASYDVLTIETCIKEWRRRHSVSRTTPGGDVQLVMRADEIRVFAMND
1z6bA1          LCLKSDN-NLFLFAGVDGVRWKKPVLPGTLTMQANLISFKSSIAKLSGVGYVNGKVVINISEMTFA----
2ownA1          TTEXVQSHGVGWVVTQYAIDITRXPRQDEVTIAVRGSAYNPYFAYREFWIRADGQQLAYITSIWVXXSQT
1iq6A           GLLGQQLPGKGSIYLGQSLSFKLPVFVGDVTAEVEVTALREDKPIATLTTTQGGALAVTGEAVVKL----
1yliA1          AILAKEIAHGRVVTVAVEMNFIKPISVG------------------------------------------
2essA2          EL------YQTKRIRRFEXAYVAESYFG---DELSFFCDEVSENEFHVEVKKGSEVVCRSKVI-------
1ixlA           AV-----NEPTVVLGKAEVRFTKPVKVGD-----KLVAKAKII---------------------------
1pn2A2          GLSAKALIDKFGXFNEIKARFTGIVFPGETLRV-LAWKESDDTIVFQTHVVDRGTIAINNAAIKLV----
2gf6A1          -----VNENLWFVIAESHAIYHRPVKLGDKLTVLNPKILSNKTIKFEFKVLKDGELTTEGYVIQI-----
1s9cA2          -----------------YLELYKPLPRAGLKCEAVVA-DVLVVIIMDVYSYSEKELICHNQFSLFLSDKV
2gvhA1          -IAATRFGRTPFVTASCEIDFRQPARIGIVEFTARPVKAGRRSLTVEVEIGRQQHTCTRGIFHXVAIPEG


                         +         .         .         .         .         *         .:210
query           TQTAxxxxxxxx
1zkiA1          ------------
1o0iA           ------------
1q4sA           ------------
2hboA1          ------------
1sh8A           RPGS--------
1j1yA           ------------
2cy9A1          ------------
2f3xA1          ------------
1tbuA1          ------------
1yocA1          ------------
2ownA2          ------------
1c8uA1          ------------
2nujA1          GS----------
1vpmA           ------------
1z54A1          ------------
2ov9A1          ------------
2av9A1          SS----------
1s5uA           ------------
2gvhA2          ------------
2aliA1          EN----------
1bvqA           GER---------
1z6bA1          ------------
2ownA1          TR----------
1iq6A           ------------
1yliA1          ------------
2essA2          ------------
1ixlA           ------------
1pn2A2          ------------
2gf6A1          ------------
1s9cA2          ------------
2gvhA1          ED----------