[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE39592.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1td5A.bssp"
#ERROR : Can't open dsspfile "1mkmA2.bssp"
#ERROR : Can't open dsspfile "1mkmA1.bssp"
#ERROR : Can't open dsspfile "1qzzA1.bssp"
#ERROR : Can't open dsspfile "2d1hA1.bssp"
#ERROR : Can't open dsspfile "1fp2A1.bssp"
#ERROR : Can't open dsspfile "2hoeA1.bssp"
#ERROR : Can't open dsspfile "1xd7A.bssp"
#ERROR : Can't open dsspfile "1q1hA.bssp"
#ERROR : Can't open dsspfile "1z05A1.bssp"
#ERROR : Can't open dsspfile "1wi9A.bssp"
#ERROR : Can't open dsspfile "1qbjA.bssp"
#ERROR : Can't open dsspfile "2htjA1.bssp"
#ERROR : Can't open dsspfile "2fnaA1.bssp"

## Summary of PDB Search
:263
    5e-22  25%  1td5A  [d.110.2.2] ACETATE OPERON REPRESSOR
    8e-21  25%  1mkmA2 [d.110.2.2] ICLR TRANSCRIPTIONAL REGULATOR A:76 -- 246
    1e-08  17%  1mkmA1 [a.4.5.33] ICLR TRANSCRIPTIONAL REGULATOR A:1 -- 75
    7e-07  26%  1qzzA1 [a.4.5.29] ACLACINOMYCIN-10-HYDROXYLASE A:10 -- 101
    3e-06  37%  2d1hA1 [a.4.5.50] 109AA LONG HYPOTHETICAL TRANSCRIPTIONAL A:1 --
    4e-06  22%  1fp2A1 [a.4.5.29] ISOFLAVONE O-METHYTRANSFERASE A:8 -- 108
    1e-05  19%  2hoeA1 [a.4.5.63] N-ACETYLGLUCOSAMINE KINASE A:10 -- 71
    1e-04  16%  1xd7A  [a.4.5.55] YWNA
    2e-04  23%  1q1hA  [a.4.5.41] TRANSCRIPTION FACTOR E
    3e-04  21%  1z05A1 [a.4.5.63] TRANSCRIPTIONAL REGULATOR, ROK FAMILY A:10 --
    6e-04  17%  1wi9A  [a.4.5.47] PROTEIN C20ORF116 HOMOLOG
    6e-04  25%  1qbjA  [a.4.5.19] PROTEIN (DOUBLE-STRANDED RNA SPECIFIC ADENOSINE
    7e-04  21%  2htjA1 [a.4.5.73] P FIMBRIAL REGULATORY PROTEIN KS71A A:1 -- 73
    8e-04  13%  2fnaA1 [a.4.5.11] CONSERVED HYPOTHETICAL PROTEIN A:284 -- 356
:263

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxLARYIDVLEVIAAFSGAITLADVSSILDLPKTTAHRLLKGLVRAGLAVEGDAGRSYYVGE
1td5A           ----------------------------------------------------------------------
1mkmA2          ----------------------------------------------------------------------
1mkmA1          ----------LKKAFEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGF-VLRKKDKRYVPGY
1qzzA1          ------------------------AGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTR
2d1hA1          ---------------------------ITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTPKYYYS--
1fp2A1          ----------WAVEMNIPNIIQNHGKPISLSNLVSILQVPSSKIRRLMRYLAHNGFEIITKEEESYALTV
2hoeA1          -------------------------SPVSRVELAEELGLTKTTVGEIAKIFLEKGIVVEEKDSPRPTKSL
1xd7A           ----------LAVAIHILSLISM-DEKTSSEIIADSVNTNPVVVRRMISLLKKADI-LTSRAGVPGASLK
1q1hA           --------------IDVLRILLDKGTEMTDEEIANQLNIKVNDVRKKLNLLEEQGF-VSYRKTRSGWF--
1z05A1          ------------NAGRVYKLIDQ-KGPISRIDLSKESELAPASITKITRELIDAHLIHETTVQEAISRGR
1wi9A           ------------FLTEFINYIKK-SKVVLLEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFI--
1qbjA           ------------QEQRILKFLEELGKATTAHDLSGKLGTPKKEINRVLYSLAKKGK-LQKEAGTPPLW--
2htjA1          ----------------ILEFLNR-HNGGKTAEIAEALAVTDYQARYYLLLLEKAGMVQRSPLRRGMATYW
2fnaA1          ----------------TLSKCGKWSDVKRALELEEGIEISDSEIYNYLTQLTKHSW-IIKEGEK-YCPSE


                         .         .         *         .         .         .         .:140
query           RLTRLLHAGxxxxxxxSLAGPHLRALTEASTETCYLARLIGSRVVVALSYSPDVRWRGYVQPGIEMPVNA
1td5A           ----------------AIVHPILRNLXEESGETVNXAVLDQSEAIIIDQVQCTHLXRXSAPIGGKLPXHA
1mkmA2          ----------------DIAHDHLVDIMKRTGETVHLILKDGFEGVYIDKVEGEQSIPMVSRLGMKVDLYS
1mkmA1          KLIEY-----------------------------------------------------------------
1qzzA1          LGMLLAD---------------------------------------------------------------
2d1hA1          ----------------------------------------------------------------------
1fp2A1          ASELLVRGS-------------------------------------------------------------
2hoeA1          KIS-------------------------------------------------------------------
1xd7A           KDPADI----------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1z05A1          PAVGL-----------------------------------------------------------------
1wi9A           YIT-------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
2htjA1          FLKGEKQAG-------------------------------------------------------------
2fnaA1          PLISLAFS--------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AATGKAIMAFQSKVLIAEALSHELPKPTINSHTSRKWIEQEFAKVRTNGYATCIGEIDEGLAAIAVPVRL
1td5A           SGAGKAFLAQLSEEQVTKLLHRGLHAYTHATLVSPVHLKEDLAQTRKRGYSFDDEEHALGLRCLAACIFD
1mkmA2          TASGKSILAFVPEKELKEYLKVELKPKTPNTITNPRVLKRELEKIRKRGYAVDNEENEIGIMCVGVPIFD
1mkmA1          ----------------------------------------------------------------------
1qzzA1          ----------------------------------------------------------------------
2d1hA1          ----------------------------------------------------------------------
1fp2A1          ----------------------------------------------------------------------
2hoeA1          ----------------------------------------------------------------------
1xd7A           ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------
1wi9A           ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
2htjA1          ----------------------------------------------------------------------
2fnaA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PNGAVLHSVGMTGPLERIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1td5A           EHREPFAAISISGPISRI-----------------------------------
1mkmA2          HNGYPVAGVSISGVARKF-----------------------------------
1mkmA1          -----------------------------------------------------
1qzzA1          -----------------------------------------------------
2d1hA1          -----------------------------------------------------
1fp2A1          -----------------------------------------------------
2hoeA1          -----------------------------------------------------
1xd7A           -----------------------------------------------------
1q1hA           -----------------------------------------------------
1z05A1          -----------------------------------------------------
1wi9A           -----------------------------------------------------
1qbjA           -----------------------------------------------------
2htjA1          -----------------------------------------------------
2fnaA1          -----------------------------------------------------