[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE39597.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1v37A.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "1upsA2.bssp"
#ERROR : Can't open dsspfile "1tpzA.bssp"

## Summary of PDB Search
:235
    2e-46  58%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    2e-42  27%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    1e-33  21%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-32  25%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    2e-29  25%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    4e-29  11%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    2e-28  13%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    1e-26   8%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-25  17%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    3e-25  12%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    2e-24  20%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    4e-24   7%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    5e-22  14%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    2e-21  32%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    4e-21  10%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    7e-21  11%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    1e-20  18%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    1e-20  14%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    1e-20   9%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    2e-20  11%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    2e-20  16%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    4e-20   8%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    7e-20   8%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    7e-20  12%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    9e-20  10%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    3e-19  11%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    3e-19  14%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    4e-19  11%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    9e-19  30%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-18  11%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    2e-18  11%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    3e-18  10%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    3e-17  13%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    3e-17   8%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    3e-17  10%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    6e-17   8%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    9e-17   6%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    1e-16  11%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    1e-16  10%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    3e-16   6%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    4e-16   8%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    1e-15   9%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    1e-15  11%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    1e-15   9%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    1e-15  14%  1g6oA  [c.37.1.11] CAG-ALPHA
    2e-15  10%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    2e-15  13%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    2e-15  13%  1jb1A  [c.91.1.2] HPRK PROTEIN
    3e-15  11%  1t3wA  [a.236.1.1] DNA PRIMASE
    6e-15  12%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    8e-15  11%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    9e-15  11%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    1e-14  14%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    1e-14  14%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    2e-14  14%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    3e-14  11%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    4e-14  11%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    5e-14  17%  1jbkA  [c.37.1.20] CLPB PROTEIN
    2e-13  13%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    2e-13  14%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    3e-13   8%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    3e-13  11%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    3e-13  12%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    4e-13  10%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    5e-13   9%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    9e-13  13%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    9e-13  10%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    1e-12  11%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    1e-12  16%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    1e-12  10%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    2e-12  16%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    3e-12  14%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    4e-12  12%  1rkbA  [c.37.1.1] PROTEIN AD-004
    4e-12  24%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    4e-12  10%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    4e-12  14%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    5e-12  10%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    7e-12  14%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    1e-11   8%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    1e-11  10%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    1e-11  12%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    5e-11  13%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    1e-10  14%  1mi8A  [b.86.1.2] DNAB INTEIN
    1e-10  11%  1sbxA  [a.6.1.4] SKI ONCOGENE
    5e-10  12%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    6e-10   9%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    8e-10  17%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    1e-09   9%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    1e-09  12%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    3e-09  14%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    6e-09  16%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    9e-09   8%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    9e-09  12%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    1e-08   7%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    1e-08  10%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    1e-08  12%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    2e-08  20%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    4e-08   9%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    4e-08  18%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    5e-08  16%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    6e-08  12%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    7e-08  10%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    8e-08   9%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    2e-07   8%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    2e-07  12%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    2e-07  14%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    2e-07   9%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    4e-07  23%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    4e-07  14%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    8e-07  12%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    1e-06   9%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    3e-06   8%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    4e-06   8%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    7e-06  12%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    7e-06  14%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    1e-05  20%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    2e-05  10%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    3e-05  11%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    3e-05   7%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    5e-05  15%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    7e-05  17%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    8e-05  12%  1v37A  [c.60.1.1] PHOSPHOGLYCERATE MUTASE
    1e-04  12%  1g31A  [b.35.1.1] GP31
    2e-04  43%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 --
    3e-04  11%  1e6vC  [d.58.31.1] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    5e-04  11%  1oa8A  [b.145.1.1] ATAXIN-1
    9e-04  14%  1upsA2 [b.42.2.3] GLCNAC-ALPHA-1,4-GAL-RELEASING ENDO-BETA- A:290
    9e-04  32%  1tpzA  [c.37.1.8] INTERFERON-INDUCIBLE GTPASE
:235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWST
1ji0A           VLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPA
1b0uA           KLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVRD
1q3hA           LEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQF
1sgwA           KLEIRDLSVGYDK-PVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPI-----
1l7vC           -----------AESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGXTS-GKGSIQFAGQPLEAWSA
1nijA1          --------------------------IAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGEVSVDD
1m3eA1          ---------------DAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGVDNFGL
1khbA1          -----------AEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQ
1e69A           -----------KGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGS
1ex6A           ---------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGE
1pf4A1          -VDVKDVTFTGKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDYKL
1t06A           ------------DFKTVMQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKIKLNQELAEELYAT
1e9rA           -GKLKRMTREKAKQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
1g6hA           ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEP
1pv4A3          --------------ARVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVLLIDERPE
1mjgM           GIKLTKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGK-IEVIGPDIDQIPE
1ffhA2          ---------------------PVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVA-------A
1jjvA           --------------------------TYIVGLTGGIGSGKTTIANLFTDLGVP---LVDADVVAREVVAK
2gx8A1          ------------------------------GAGHIGNYSHCTFSSEGTGTFVPQQLEVRIETI-IPASLQ
1e6cA           ---------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGVAD
1bgxT2          ----------------------------------------------MLPLFEPKGRVLLVDGHHL-----
1bmfA3          IIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVA
1kgdA           --------------------------RKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPEENG
1mukA           ------------------------------WRMCEAREPSVDLLPLCAGI-DPLNSDPFLKMVSVGPMLQ
1jalA1          --------------------------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPDPRL
2v3jA1          ----------------PPVLTSKDKITKRXIVVLAXASLETHKIYVLLNCDDH-QGLLKKXGRDISEARP
1c4oA1          ----RGPSPKGDQPKAIAGLVEALRDGEFVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQLAA
1d6jA           ----------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFG
1vplA           -VVVKDLRKRIGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPH
1zp6A1          --------------------------GNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWGYIK--
1tljA           ------LVWEELREKALNKIYHDKEIGYLDPDIL------GFLLAFYRNRNDVYTQSSCSGRITIVDAEM
2yyeA2          ----------------------GAQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLALNDKAR
1qhlA           --------LTLINWNGFFARTFDLD-ELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKLKAGVCYS
1n25A           ---------------------YNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELG
1tmkA           ------------------------GRGKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERSTRIGGL
2iqhA1          -------ATAGLTHMMIWHSNLNDATYQRTRALVRTG-MDPRMCSLMQGSTLPRRSGAAVKGVGTMVM--
1afrA           ---------------VHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGVRD
1udwA           --------------------------PFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVLTSE
1es6A2          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1xbtA1          --------------------------GQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRAL
1f46A           -----------------------------------------IIMNVAAHHGSELNGELLLNS--------
1urjA           -----------LYLVVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMPDRVIAEPFN
1ohcA1          ---------------------------------------------------RDPQDDVYLDITDRLCFAI
1g6oA           FEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIEDTEEIVFKH
1j1zA2          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------AADWA-
1jb1A           ------------ERRSXHGVLVDIY-GLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQDEQTI
1t3wA           ---------------------------------------KRTTXRILIGLLNPELATLVPPLENLDENK-
1qhdA1          ----------DNSSEYIENWNLQNRRQRTSVLADASETMLANVTS-VRQEYAIPVGPVFPPGMNWTDLIT
1e3mA2          -----------LNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQKV-EIGP
1ak2A1          --------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGS
1bs2A1          ----------------------------------------------------------------------
1fl9A           -IPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEYNI
1lw7A2          ---------------------ARPFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKLG-
1zs3A1          ----------------------------------------------------------------------
1viaA           ---------------------------KNIVFIGFXGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQKV
1jbkA           -------------EIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALDM
1ni3A1          -----------------KVQWGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPEEAKV
1s9hA           ILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTN----ENFPF
1l3aA           ---------------------------------------------------KVFVGYSIYKGKAALTVE-
1grqA           -------------------------TTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLK
2axpA1          -----------------------------IILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEK
1atrA1          -----------------KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA
1cd5A           -VSFKHVVTFNMDYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGK
1np6A           --------------------------IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHELRK
1poiA           ---------------LKDAIAKYVHSGDHIALGGFTTDRKPYAAVFLTGLGGAAGGDW---DMLIGNGRV
1i1qA           ----------RVVGELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGSYG-----------
2f9hA1          ----------------------------------------------------------------------
1g8yA           -HKPINILEAFAAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLA-------------LQL---AAQIAGG
1cr0A           -----------SGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMG--------------
1dnpA2          ----------------------------------------------------------------------
1rkbA           --------------------------LPNILLTGTPGVGKTTLGKELASKSGLKYINVDLAREEQLYDGY
1f2t.1          ----------------------------------------------------------------------
2ancF1          --------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLADWQGA
2pa7A1          ----------------------------------------------------------------------
1l7lA           -------------------VLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLI
2vgmA3          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1ii8.1          ------------------------------------------------------------------TEEL
1mi8A           RVSIKDLLDEKDFIWAINEQTMKLESAK-VSRVFMTGKKLVYILKTRLGRTIKATANHRFLTIDGWKRLD
1sbxA           ----------------------------------------------------------------------
3cddA2          -LKAGGKIYQGGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVITGYVDDWV
1ckvA           ----MGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPWIKANGKIEVDC
1em8A           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1ovmA2          VIDSPDICWVGCELNASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAPGTAAQQ
1yj5A2          ---------------------------EVVVAVGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCVSS
1v47A1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1b77A2          ----------------VASVITEIKAEDLQQLL-----RVSRGLQIDTIAITNKDGKIVINGYNKVEDSG
2vnuD1          RIRTRRAAELLDKRIVISIDSWKYPLGHFVRDLGTIESAQAETEALLLEHDVEYR---------------
1bccF           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
2je6I3          ------------------GIVIDIMPVKVPRVIGKNKSMYETLTSKS--IFVANNGRIWAFSEEILIEAI
1odfA           -----------------------------IFFSGPQGSGKSFTSIQIYNH--------------LMEKYG
1esmA           -----------QAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLH
3cddA1          ----------------------------------------------------------------------
1t9hA2          ------------------------------------------------------SGGLVADTPGFSSLEF
2gtlM1          ----------RVWLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAPLKGQSEGYG-VICDFNLGDDD
1jqjA3          ---------------KFRGVRLYVSENQLKITANNPEQEEAEEIL-----------DVTYSGAEMEIGFN
1yr6A1          -----------------------------VVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVKELP
1zbsA1          ----------------------------------------------------------------------
2gujA1          ------------------------------------KKGSDPYFTLQAVLDDQSSGRVTLYDVNFDS---
1d8jA           ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1l1oA           --------MMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFI--LSDGEGKNGTIELMEPLDEEI
1yvuA2          ----------------------------------------------------------------------
1g8fA3          ----------------------RPKQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIF-------
1tueA           ---------------ALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISF------------
1q3tA           --------------------------TIQIAIDGPASSGKSTVAKIIAKMYRAATYMALKNQLGVEEVEA
1w1wA           ----------------------------------------------------------------------
1e2hA           ------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETI
1o7d.2          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1ckeA           ------------------------AIAPVITIDGPSGAGKGTLMAEALQWHLLDSGAI-YRVLALAALHH
1v37A           ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1lnzA2          ----------------------------DVGLVGFPSVGKSTLLSVVSS---------------------
1e6vC           ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1upsA2          ----------------------------NNYLIRNRQTGKFLYIEENNDKVSYGDITLKNEKNA------
1tpzA           ----------------------------NVAVTGETGSGKSSFINTLRGIGNEEEG--------------


                         .         .         *         .         .         .         .:140
query           DRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQLGWSLSGGE
1ji0A           HVINRXGIALVPEGRRIFPELTVYENLXXGAY-NRKDKEGIKRDLEWIFSLFPRLKERLKQLGGTLSGGE
1b0uA           KDGQLKVLTMVFQHFNLWSHMTVLENVMAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQ
1q3hA           SWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKF------------AEQDNTVLGEGGVTLSGGQ
1sgwA           -TKVKGKIFFLPEEIIVPRKISVEDYLKA----VASLYGVKVNKNEIMDALESVEVLDLKKKLGELSQGT
1l7vC           TKLALHRAYL---SQQQTPPFATPVWHYLTLHQHDKTRTELLNDVAGALALDDKLGRSTNQL----SGGE
1nijA1          QLIGDRATQI-KTLTNGCICCSRSNELEDALLDLLDNLDKGNIQFD-----RLVIECTGMADPGPIIQTF
1m3eA1          GKQIKRXISSYVGENAEFERQYLAGELEVELTPQGTLAERIRAGGAGVPAFSTGYGTLVQEGGSPIKYNK
1khbA1          GHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLASGVTITSWKNKE
1e69A           AYVELVFEENGEEITVARQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLSGGE
1ex6A           VNGKDYNFVSVDE----FKSMIKNNEFIEW-AQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKA
1pf4A1          TNLRRHFALVSQNVHLFNDTIAAYAAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSGGQ
1t06A           GNYDAMYFAGII---ADPKAMSESDFDRWIDGAYFYM---LSDYVVAVTLSESNIAQDVADKWIASGDEL
1e9rA           FGR---DKDIILNPYDQRTKGWSFFNE-IRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLA
1g6hA           AELYHYGIVRTFQTPQPLKEMTVLENLLLNSLFYKKWIPKEEEMVEKAFKIFLKLSHLYDRKAGELSGGQ
1pv4A3          EVTEXQRLVKGEVVASTFDEPASRHV--QVAEXVIEKAKRLVEHKKDVIILLD----------SITRLAR
1mjgM           GSKLPLGILVDIYGRKMQADFEGVLE-----RRIHDFINYGEGLWHTGQRNINWLRVSKDAVAKGFRFKN
1ffhA2          DTQRPAAREQLRLLGEKVG------------VPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRL
1jjvA           DSPLLSKIVEHFGAQILNR--------------AALRERVFNHDEDKLWLNNLLHPAIRERMKQKLAEQT
2gx8A1          RKVIKAMVTAHPYEEVAYDVYPLDNKGETLGLGKIGYLQEEM----TLGQFAEHVKQSLDVKGARVVGKL
1e6cA           VVAAEGWPGFRRRESEALQAVATPNRVVATGGGMFMRAHGTVVYLFAPAEELALRLQASLQAHQRPTLTG
1bgxT2          -------AYRTF---HALKGLTTSRGVQAVYGFAKSLLKALKEDGDAVIVVFKAPSFRHEAYGGYKAGRA
1bmfA3          IGQKRSTVAQLVKRLTDADAMKYTIVTASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAY
1kgdA           KNYYFVSHDQMMQDISNNE----------YLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVL
1mukA           STR--KYFAQTLFMAKTVSGLDVNAIDSALLRLRTLGADKKALTAQ--LLMVGLQESEADALAGKIMLQD
1jalA1          DALAEIVKPERILPTTMEF--VDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENIDPLDDIDTI
2v3jA1          DITHQCLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRT-FKRFSGLXVQLLHKLSIRSEEKLLK
1c4oA1          EFRELFPENAVEYFISYYDYYQPEAYV-PGKDLYIEKDASINPEIERLRHSTTRLLTRRDVIVVASVSAI
1d6jA           LNKDLGFSEADRNENIRRIA-----------EVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGE
1vplA           EVRKLISYLPEEAGAYRNM---QGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVSTYSKGM
1zp6A1          HGRIDPWLPQSH---QQNRXIXQIAADVAGRYAKEGYFVILDGVVRPDWLPLARPLHYIVLRTTAAEAIE
1tljA           PWDRKNSTIIFKNHLRITEDVLSKNQVRRLWLIVQGPIIHIYAKNIETGWDILKIAREAGFKHSGILATN
2yyeA2          NLMLSLDATACTDVTGFGWNICKNSNIGARIFFEKVPYYQLSENLVKKKIYPKAIENLNFVKNYLKSNLD
1qhlA           MQRVVVGV-RLQQVAGRDRKVDIKPFAIQGLPMSVQPTQLVTLPLNELKDKLEAMEGVQFKQFNSITDYH
1n25A           VEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQARF
1tmkA           INEYLTDDSFQLSDQAIHLLFSANRW-----EIVDKIKKDLLEGKNIVMDRYVY-SGVAYSAAKGTNGMD
2iqhA1          --ELIRMIKRGINRRTRIAYERMCNILKGKFQTAAQRTMVDQVRESRNPGNAEFEDIFLARSALILRGSV
1afrA           ETGASPTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEK--TIQYLIGSGMDPRTENSPYLGFIY
1udwA           QKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPV-----------YDFVSHSRKEETVTVYPAD
1es6A2          ----------------LRPGISFHPKLRPLLPNKNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIE
2gk3A1          -------LFIGE---SWHIHXIHSKGYDSFTSSKYEEGATWLLECLRKGGVYXPAHTVQIAFPESIDELN
1xbtA1          PACLLRDVAQEALGVAVIGIDEGQFFPDIV----------EFCEAMANAGKTVIVAALDGTFQRKPFGAI
1f46A           ----IQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGFDPEMKDFTTPGVTIFMQVPSYGDELQLF
1urjA           ANHRSIGEKFTYPLPFFNRPLNRLLFEAVVPAAVALRSRNVDAAFDENHEG-AALPADITFTAFAGGFEQ
1ohcA1          LYSRPKSHYFSID--NELEYENFYADFGPLNLAMVYRYCCKINKKLKSITM------LRKKIVHFTGSDQ
1g6oA           HKNYTQLFFGGN----ITSADCLKSCLRXRPDRIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEA
1j1zA2          -----------------GVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEF------FEGDPVAVNGER
1mm8A           -KSVFSSAALGDPRRTA---RLVNVAAQLAKYSGKSITISSEGSKAAQEGAYRFIRNPNVSAEAIRKAGA
1jb1A           VGAAPPILSH----LLEIRGLGIIDVLFGAGAVREDTTISLIVHLENWTPDQLIFDVPVPKITVPVKVGR
1t3wA           -------LPGLGLFRELVNTCLSQPGLTTGQ--LLEHYRGTNNAATLEKLSXWDDIADKNIAE--QTFTD
1qhdA1          NYSPSREDNL----QRVFTVASIRSML-------------------------------------------
1e3mA2          IDRIFTRVGFXVEXTETANILHNATEYSLVLXDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYF
1ak2A1          ELGKKLKATAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSI
1bs2A1          ------------------------------------------------------TGPYLQYAHSRLRSVE
1fl9A           AGKMIYHFDLYLADPEELEFMGIRDYFNTDSICLIEWSE-KGQGILPEADILVNIDYYDDARNIELIAQT
1lw7A2          GDEQAMQYSDYPQXALGHQRY---------IDYAVRHSHKI---------AFIDTDFITTQAFCIQYEGK
1zs3A1          ----ELDKAEIDHHKPTAGAMLVLSNLFIENIRLTQAGIYASPVKCEYLREIAQREVEYFFKISDLLLDE
1viaA           SFEQKRENFFREQEQKXADFFSSCEKACIATGGGFVGFCIYLKADFEYLKKRLDKDEISKRPLFYDEIKA
1jbkA           GALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAMDAGNMLKPAARGELHCVGATTLDEY
1ni3A1          AVPDERFDWL---CEAYKPKSRVPAFLTVFDIAGLTKGASTGVGLGNAFLSHVRAVDAIYQVVRAFDDAE
1s9hA           NDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCA-----VIDGN
1l3aA           -PRSPEFSPLDSGAFKLSREGMVMLQFAPAAGVRQYRKQVFSLSVTEIGSIISLGTKDSCEFFHDPNKGR
1grqA           MQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFL---GGAAAQERWRSFVGDLD
2axpA1          LFEHFNKLADEDNVIIVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAVIKKRLRVRGDEYI--EGKDI
1atrA1          KNGRRFDDAVVQSDMKHWPFMVVNDAGRPFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQ
1cd5A           IHLFMGGVGNDGHIAFNEPASSLASRTRIKVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCV
1np6A           AGAAQTIVASQQRWA------------------LMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEE
1poiA           KAYINCYTANSGV---TNVSRRFRKWFEAGKLTMEDYSQDAAALGLPFLPVTLMQGSGLTDEWGISKEVR
1i1qA           -----GAVGYFTAHGDLDTCIVIRSALVENGIATVQAGAGIVLDSVPQSEAD-ETRNK--------ARAV
2f9hA1          -TEIGKHAIDDSEKXIILFGETATDTLKQH-AVIQSFPEKDQVTLAEGDHLKIGDTNYTITKVGSFANSN
1g8yA           PDLLEVGELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAPEWFDGL
1cr0A           -KKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFD--ELFGNDTFHLYDSFAEAE
1dnpA2          -----------------RQDLRLHDNLALA------------AACRNSSARVLALYIATPRQWATHNMSP
1rkbA           DEEYDCPILDE----DRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRLYERLETRGYNEKKLTD
1f2t.1          ------------------------------------------------------VWEGKERPLTFLSGGE
2ancF1          QQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTD
2pa7A1          -------------------------------------------DTKGEEPRGFHAHKKLEQVLVCLNGSC
1l7lA           CHD--AFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYND--------VPGTYGN----NSGSF
2vgmA3          -------------------------------------------------MVMDEFLLHLNKDDDKAWYGE
1f8xA           -------------------------------------------------------KKTIYFGAGWFTDRQ
1dhyA1          -----------------------------------------------------AWDHFLTKSVGLMAAGS
2qgmA1          -------------------------------------------------NIVKSIQSQANPLKTIEPSKP
1ii8.1          IEKVKKYKALARE-AALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRWEGKERPLTFLSGGERIALGL
1mi8A           ELS-LKEHIALPRKSDISWDSIVSITETGVEEVFDLTVPGPHN---------------------------
1sbxA           ----------------------------------------------------------------DRSTER
3cddA2          PSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFKVIVNTDVGEPFQRIQIEQGE
1ckvA           -DEISELLGRQFNVYDFLVDVSST----------------------------------------------
1em8A           ----------------------------------------------------------------------
1vhhA           --------------------------------------QFIPNVAEKTLGASGRYEGKI------TRNSE
1ovmA2          RGE---LLHHTLGDGEFRHFYHMSEPITVAQ-AVLTEQNACYEIDRVLTTM---LRERR-----------
1yj5A2          CQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVPCRNFCATIEQARHNNRFREXTDPSHAPVSDXVXF
1v47A1          ----------------------------------------------------------------------
1xl3C1          -----------------DLSEFMGDIVALVDXRWAGIHDIELPTPEIXVRFYQDLXRMFRLFPLGVFSDE
1b77A2          LTRPKYSLTTDYDGSNNFNFVINMANMKIQPGNYKVMLWGAGDKVAAKFESSQVSYVIAMEADSTHD---
2vnuD1          ----------------------------------------------------------------------
1bccF           -WYYNAAGFNKY---GLMRDDTIYENDDVKEAIRRLPENLYDDRMFR----IKRALDLNMRQQILPKEQW
1gm5A1          ----------------LFLWGEALPTLLEEFLNEVEKMLKNQVNTRR-IHQLLKELDDPLLENKDLEEKL
2fggA1          ------------------------------------------------------EHDERTRAKARLSWAG
1a4iA2          ----------------------------------------------------------------------
2je6I3          RKIENES---------------------------------------------------------------
1odfA           GEKSIGYASIDDFYLTHEDQLKLNEQFKNNKLLQGRG-LPGTHDMKLLQEVLNTIFNQDTKYDKSQFKGE
1esmA           PNQVLKERGL----------------------XKKKGFPESYDXHRLVKFVSDLKSGVPNVTAPVYSHLI
3cddA1          -------------------------------------KTKAGVSLILGDNVKAARFSWRQRFSKFTIKAA
1t9hA2          TDIEEEELGYTFPDIREKSSSCKFRGCLHL----KEPKCAVKQAVEDG-----ELKQYRYDHYVEFMTEI
2gtlM1          HAD-------------------------------------------------------------------
1jqjA3          VSYVLDVLNALKCENVRMM-LTDSVSSVQ-----------------------------------------
1yr6A1          YEPSIDVREFVTVEEIMREGYGP-----------------------------------------------
1zbsA1          -----------------------SEGIACIL---GTGSNSCLFDGREIKANVSPLGYILGDEGSGAVLGR
2gujA1          ----------------------------------------------------------------------
1d8jA           -------------------------------------------------DTHPLTLDEILDETQHLDIGL
1uouA3          ----------------------------------------------------------------------
1l1oA           SGIVEVV--GRVTAKATILCTSYVQFK-------------------------------------------
1yvuA2          --------------------------------------------------------------ISRITRDG
1g8fA3          EHNNKTELLSLIQDFIGSGSGLIIPDQWEDDKDSVVGDTSSSADIQLESADEPI-SHIVQK---------
1tueA           ----------------------------------------------------------------------
1q3tA           LLALLDQHPISFGRSETGDQLVFVGDVDITHPIRENEVTNHVSAIAAIPEVREKLVSLQQEI-----AQQ
1w1wA           -----------------------------------------------------------------LSGGE
1e2hA           ANIYQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCY
1o7d.2          -----------------------------------------------------------------YNPLG
1iioA           ------------------------------------------------AALPNGPDTTCKSGDVELKASD
1dwmA           ----------------------------------------------------------------------
1ckeA           HVDVAS-EDALVPLASHLDVRFVSTNGNLEV---ILEGEDVSGEIRT------QEVANAASQVAAFPRVR
1v37A           ---------------------------------ALPSLPAFSSDLLRARRTAELFSPRLYPELREIHFGA
1g31A           ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1e6vC           -----------------------------------------------------------------KYMNP
1oa8A           -----------------FMKGSIIQLANGELKKVEDQSAEISNDLKIDSSTVERIEDSHSPGVAVFAVGE
1upsA2          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLET
1ji0A           QQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHYGYVLET
1b0uA           QQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQ
1q3hA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK-LMANKTRILVTSKMEHLRKADKILILHQ
1sgwA           IRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSIEILKEKGIVIISSREE----LSYCDVNENLHK
1l7vC           WQRVRLAAVVLQIGQLLLLDEPXNSLDVAQQSALDKILSALCQQGLAIVXSSHDLNHTLRHAHRAWLLKG
1nijA1          FSHEVLCQRYLLDGVIALVDAVHADEQMNQFTIAQSQVG---YADRILLTKTDVAGEAEKLHERLARINA
1m3eA1          DGSIAIASKPREVREFNGQHFILEEAIRGDFALVKA-WKADQAGNVTFRKSARNFNLPXCKAAETTVVEV
1khbA1          WSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGV--PLVYEALSWQHGVFVGA
1e69A           KALVGLALLFALPSPFYVLDEVDSPLDDYNAERFKRLLKENSK-HTQFIVITHN-KIVMEAADLLHGVNG
1ex6A           IPELNARFLFIAPPSVEDLKKRLEGRGTETEESINAELAYAETGAHDKVIVNDDLDKAYKELKDFIFAE-
1pf4A1          RQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVIAHRLSTIEQ--ADEILVVDE
1t06A           KMSAGWSWLLGNRKDNAFSESKISDMLEMVKDTIHHSPETKSAMNNFLNTVVPLHEKAVEIAKEVGIVEV
1e9rA           LIGTPSMRELFHWTTIATFDDLRGFLEGTLAESL------------------------------------
1g6hA           MKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFN
1pv4A3          AYNTVVPAVLTGGVDANALHRPKRFFGAARNVEEGGS-----LTIIATALIDTGSKXDEVIYEEFKGTGN
1mjgM           YGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVARKYKERDDRMRGFYSCVLCQSFAPNHVCIVTP
1ffhA2          QIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARFDEKVGVTGLVLTKLDDARGGAALSARHVTG
1jjvA           APYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQIQRIMNSQVSQQ--ERLKWADDVINNDA
2gx8A1          DDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHAHDAMMLGLNIVDPGVEKVMKQGVQKQLQEKVD
1e6cA           RPIAEEMEAVLREREALYQDVAHYVVPAAIVCELMQTMRL------------------------------
1bgxT2          PTPEDFPRQLALIKELVDLGLARLEVPGYEADDVLALAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHP
1bmfA3          RQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTA-LPVIETQAGDVSAYIPTNVISITD
1kgdA           RTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDI-LQRTYAHYFDLTIINNEIDETIRHLEE--AVE-
1mukA           VNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDRHLNTDIPPRMGW----------LRAILRFLGA
1jalA1          NTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILVLENAGMIRSVGLDKEELQAIKSYNFLTL
2v3jA1          VIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEKLDDDE-----SICVFVGAXARGKDNFADEYVEKVGL
1c4oA1          YGLGDPREYRARNLVGFVLFPATHYLSPEGLEEILKEIEKELWERVRY----------------------
1d6jA           ETGLPFVEVYVDVPVEAPYEAPAVKNYELPVQDAVKQIDYLDTKGYLP----------------------
1vplA           VRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEVEFLCDRIALIHN
1zp6A1          RCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINALQSGRFRI-----------
1tljA           QKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLARGKQKMNLLKD----------------
2yyeA2          NWKLILLSDPVTSGGLLFTINKE------KLEKIDETAKELEVNYWIIGETIAENVLEV-----------
1qhlA           SLMFDLLRSASDRSKFYRLIEASGGISSAITRSLRD----------------------------------
1n25A           VKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLWYRPVAEFAQSIQSRIVEWKERLDKEFSLSVY
1tmkA           LDWCLQPDVGLLKPDLTLFLSTQFGDERYETVKFQEKVK--------QTFMKLLDKEIRKGDESITIVDV
2iqhA1          AHKSCLPACVYGSAVASGYDFEREGYSLVGIDPFRLLQNSQ------VYSLIRPNENPAHKSQLVWMACH
1afrA           TSFQERATFISHGNTARQAKEHGDIKLAQICGTIAA------DEKRHETAYTKIVEKLFEIDPDGTVLAF
1udwA           VVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPT
1es6A2          VPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASL-------------------
2gk3A1          RYDVIVISDIGSNTFLLQNETFYQLKIKPNALESIKE--YVKNGGGLLXIGGYLSFXGIEAKANYKNTVL
1xbtA1          LNLVPLAESVVKL---------------------------------------------------------
1f46A           KLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDAN-------------------------
1urjA           RLASVMAGDAALVSMAVFDEPPTDISAWPLFEGQDTAAARA-----------------------------
1ohcA1          RKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSDAAYGSCNFYITLLDCFHAVKKAM-----------
1g6oA           FIRLASNSAARNIKFESLIEGFKDLI-----DXI---VHINHHKQCDEFYIK------------------
1j1zA2          LSPAAL----LQRLNEIGGRHGVGRVDIVENRFVGMKSGVYETPGGTILYHARRAVESLTLDREVLHQRD
1mm8A           MQTVKL----AQEFPELLAIEDTTSLSYRHQVAEELG-KLGSIQDKSRGWWVHSVLLLEATTFRTVGLLH
1jb1A           NLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLI------------------------------------
1t3wA           SLNHXFDSLLELRQEELIARERTHGLSNEERLELWTLNQ-------------------------------
1qhdA1          ----------------------------------------------------------------------
1e3mA2          ELLPEKXEGVANVHLDALEHGDTIAFXHSVQDGAASKSYGLAVAAL-AGVPKEVIKRARQKLRE------
1ak2A1          PDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYSKRGIHSAIDASQTPDVVFASILA------
1bs2A1          RNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFKL---THQVSSCYDV
1fl9A           NLGKNIISAF------------------------------------------------------------
1lw7A2          AHPFLDSXIKEYPFDVTILLKN------------------------------------------------
1zs3A1          NEIVPSTTEEFLKYHKFITEDPKAKYWTD-EDLLESFIVDFQAQNMFI-------TRAIKLANKEEKFAL
1viaA           KKLYNERLSKYEQKANFILNIENKNIDE-LLSEIKKVIK-------------------------------
1jbkA           RQYIEKDAALERRFQKVFVAEPSVEDTI------------------------------------------
1ni3A1          IIHVEGDVDPIRD--LSIIVDELLIKDAEFVEKHLEGLRKITSRG-------------------------
1s9hA           STTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFY----------------
1l3aA           SDEGRVRKVLKVEPL---PDGSGHFFNLSVQNKLINLDE-----NIYIPVTKAEFAVLVSAFNFVMPYLL
1grqA           VLWVGV------RCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWA------
2axpA1          DSILELYREVXSNAGLHTYSWDTGQWSSDIAKDIIFLVE-------------------------------
1atrA1          RQATKDAGTIAGLNVLRIINEPTAAAIAYGLD--------------------------------------
1cd5A           NHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL------------------------
1np6A           IAKIVLFRDGAGHRPEELVIDRHVIAVASPLNLDVALLDINDVEGLADFVVEWM----------------
1poiA           KTLDKVPDDKFKYIDNPFKP--------------------------------------------------
1i1qA           LRAIATAH--------------------------------------------------------------
2f9hA1          LQSIAHSTLIFADAPTDEDDVIR-------NGVYLTPHQLPKTIGTTIDYL-------------------
1g8yA           KRAAEGRRLMVLDTLRRFHIEEENASGPMAQVIGRMEAIAADTGCSIVFLHHAVLVDNIRWQSYLSSMTS
1cr0A           TDRLLAKLAYMRSCDVIILDHISIRKM--IDNLMTKLKGFAKSTGVVLVVICHLKDLLRQLSDTIIALER
1dnpA2          RQAELINAQLNGLQIALAEKGLLFREVDDFVASVEIVKQVCAENSVTHLFYNYQYEVNERARDVEVERAL
1rkbA           NIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKW-IEQWIKDHN----------------
1f2t.1          RIALAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEEL-KDAADHVIRI--
2ancF1          LKTIIRAERLRMSRQKQRHDALISKL--------------------------------------------
2pa7A1          RVILDDGNI----IQEITLDSPAVGLYVG--PAVWHEMHDFSSDCVMMVLASDYYDETDYIRQYDNFKKY
1l7lA           SVNIGKDQS-------------------------------------------------------------
2vgmA3          KE-VVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACI
1f8xA           NKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNNDLNGIKTNDIMLGVYI
1dhyA1          AGDAALYRADQRAWRIAVQPGELDDLAYLEVDDAAALERMADKLRQAGVAFTRGDEAL--MQQRKVMGLL
2qgmA1          FEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXGFTNFAXEEDWGNGLKLNEYIQTGKG
1ii8.1          AFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHD-EELKDAADHVIRISL
1mi8A           ----------------------------------------------------------------------
1sbxA           CETVTISCFVVGGEKRLCLP--QILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVXGIPFSAPS
3cddA2          TPHELLARLA-KQRGVLLTSDTFGNLVI------------------------------------------
1ckvA           ----------------------------------------------------------------------
1em8A           ----------MKNATFYLLDNDTTVDGLSAVEQLVCEIAERWRSGKRVLIACEDEKQAYRLDEALWARPA
1vhhA           RFKELTP---NYNPDIIFKDEENTGADRLMTQRCKDKLNSVMNQWPGVKLRVTEGWDEDGHHSEESLHYE
1ovmA2          ----------------------------------------------------------------------
1yj5A2          SYRKQFEPPTLAEGFLEILEIPFRLQEH-LDPALQRLYRQFSE---------------------------
1v47A1          -PALEIGEDERLDLENLA-TGAFFPVKGFEALSVAHEMRLPTGEVWTIPILQFREKPRVGPGNTVALLHG
1xl3C1          EQRQNLLQMCQNAIDMAIESE-------------------------------------------------
1b77A2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1bccF           TKYEEDVPYLEPYLKEVI----------------------------------------------------
1gm5A1          QAFLDYVKEIP------NLPEARKRYRIQKSLEMIE---KLRSWFLIDYL--------------------
2fggA1          RQXVGVGLAR-----LDPADEPVAQIGDEL-----AIARALSDLANQLFALTSSDIEAST----------
1a4iA2          -------------PAEILNGKE---ISAQIRARLKNQVTQLKEVPGFTPRLAILQVGNRDDSNLYINVKL
2je6I3          ----------------------------------------------------------------------
1odfA           GDRCPTGQKIKLPVDIFILEGWFLGFNPILQGIENNDL--------------------------------
1esmA           YDVIPDGDKTVVQPDILILEGLNVLQSGXDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRFLKFRE
3cddA1          KADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWQRSIGKSNXAEYTVTGWRIPQTGKLWNINTLVPVIDE
1t9hA2          KD--------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1zbsA1          LFIGSLLKGQ---XPEGLCEAFLQEYGLTSADIIESVYRKPFP-NRFLAGF-------------------
2gujA1          ----------------------------------------------------------------------
1d8jA           KQKQWLMTEALVNPKIEVIDGKYAFKPK------------------------------------------
1uouA3          --------------------------AREQEELLAPADGVELVRALPLALVLHELGALRLGVGAELLVDV
1l1oA           ----------------------------------------------------------------------
1yvuA2          KTVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKA--------IGDVFSLLEKL-GFKKGSKIVVHRD
1g8fA3          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1q3tA           GGIVMDGRDLPQAELKIFLVASVDERAERRYKENIAKGIETDLETLKKEIAAHRETSPLKQAEDAVYLDT
1w1wA           KTVAALALLFSYQPPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTM-FEKSDALV----
1e2hA           PAARYLMGSMTPQAVLAFVALIPPTLPGTNEDRHIDRLAKRQGERLDLAMLAAIRRVYGLLANTVRYLQC
1o7d.2          RKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLFSALVPAVG--FSIYSVSQMPRDLVIQN
1iioA           AGQVLTADDFPFKAEEVADTIV------------------------------------------------
1dwmA           ------------------------------GNMAAATVERENRNVHAIVLKEGSAMTKDFRCDRVWVIVN
1ckeA           EALLRRQRAFRELPGLIADAPVKIFLDASSEERAHRRMLLQVKGFSVNFERLLAEIKLVPAADALVLDST
1v37A           LEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVRFLEGLKAPAVLFTHGGVVR-AVLRAL-----
1g31A           -------PIRAVGEYVILVSEPAQAGDEEVTESGIIGKRVQGEVPELCVVHS----VGPDVPEGFCEVGD
1lnzA2          ----------------------------------------------------------------------
1e6vC           NYELKKLREIPDEDIVRLMGHREPGEEYPSVHPPLEEME-------------------------------
1oa8A           HRAQVSVEVLVEYP-FFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISL-------------------
1upsA2          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GRIVLEGPASELKHNARVREAYLGR
1ji0A           GQIVLEGKASELLDNEXVRKAYLG-
1b0uA           GKIEEEGDPEQVFGNPQSPQQFLK-
1q3hA           GSSYFYGTFSELQSLRDFSSKLMGY
1sgwA           Y------------------------
1l7vC           GKXLASGRREEVLTPPNLAQAY---
1nijA1          RAPVYTVTHGDIDL-----------
1m3eA1          EEIVDIGSFAPE-------------
1khbA1          AMRSEAKIIMHDPFA----------
1e69A           VSAIVPV------------------
1ex6A           -------------------------
1pf4A1          GEIIERGRHAD--------------
1t06A           KRDNKKSSLLNASES----------
1e9rA           -------------------------
1g6hA           GQIIAEGRGEEELSDPKVVEIYIG-
1pv4A3          XELHLSRKIAEKRV-----------
1mjgM           ERVGLCGAVSWLDAKASYE------
1ffhA2          KPIYFAGLEPFYPE--RLAGRILGM
1jjvA           ELAQNLPHLQQKVLELH--------
2gx8A1          AKKLNVHIHASQ-------------
1e6cA           -------------------------
1bgxT2          EGYLITPAW----------------
1bmfA3          GQIFLETELFYKGIRPAI-------
1kgdA           -------------------------
1mukA           GMVMTAGVAVDIYLEDIHGGG----
1jalA1          KPTMYIANVNEDGFENNPYLDRVRE
2v3jA1          SNYPLSASVACSKFCHGAEDAW---
1c4oA1          -------------------------
1d6jA           -------------------------
1vplA           GTIVETGTVEELKERYKAQNIE---
1zp6A1          -------------------------
1tljA           -------------------------
2yyeA2          -------------------------
1qhlA           -------------------------
1n25A           QKMVAMGI-----------------
1tmkA           TNKGIQEVEALIWQ---IVEPVLST
2iqhA1          SAAFEDLRVSSFIRGTKVVPRG---
1afrA           ADMMRKKISMPAHL-----------
1udwA           KKYA---------------------
1es6A2          -------------------------
2gk3A1          AEVLPVIXLDGDDR-----------
1xbtA1          -------------------------
1f46A           -------------------------
1urjA           -------------------------
1ohcA1          -------------------------
1g6oA           -------------------------
1j1zA2          MLSPKYAELVYYGFWYAPEREAL--
1mm8A           QEWWMRPDDPADADEKESGKWL---
1jb1A           -------------------------
1t3wA           -------------------------
1qhdA1          -------------------------
1e3mA2          -------------------------
1ak2A1          -------------------------
1bs2A1          LWVAGQTEELATARLALYGRQVLYN
1fl9A           -------------------------
1lw7A2          -------------------------
1zs3A1          AAGVVELYGYNLQV-IRNLAGDLGK
1viaA           -------------------------
1jbkA           -------------------------
1ni3A1          -------------------------
1s9hA           -------------------------
1l3aA           GWHTAVN------------------
1grqA           -------------------------
2axpA1          -------------------------
1atrA1          -------------------------
1cd5A           -------------------------
1np6A           -------------------------
1poiA           -------------------------
1i1qA           -------------------------
2f9hA1          -------------------------
1g8yA           AEAEEWGVDDDQRRFFVRFGVSKAN
1cr0A           NQLV---------------------
1dnpA2          RNVVCEGFDDSVILPPGAVMTGNH-
1rkbA           -------------------------
1f2t.1          -------------------------
2ancF1          -------------------------
2pa7A1          IAKI---------------------
1l7lA           -------------------------
2vgmA3          LK-----------------------
1f8xA           PDEEDVGLGMELGYALSQKYVLL--
1dhyA1          CLQDPFGLPLEIYYGPAEIEPFLP-
2qgmA1          NPRE---------------------
1ii8.1          ENGSSKV------------------
1mi8A           -------------------------
1sbxA           CGLITKTDAERLCNA----------
3cddA2          -------------------------
1ckvA           -------------------------
1em8A           ESFVPHNLAGE--------------
1vhhA           GRAVDITTSDRDRSKYGMLARLAVE
1ovmA2          -------------------------
1yj5A2          -------------------------
1v47A1          GERVALLHVAE--------------
1xl3C1          -------------------------
1b77A2          -------------------------
2vnuD1          -------------------------
1bccF           -------------------------
1gm5A1          -------------------------
2fggA1          -------------------------
1a4iA2          KAAEEIGIKATHIKL----------
2je6I3          -------------------------
1odfA           -------------------------
1esmA           GAFTDPDSYFHNYAKLTKEEAI---
3cddA1          EXLIASILFSEDD-AGRLAVISVVR
1t9hA2          -------------------------
2gtlM1          -------------------------
1jqjA3          -------------------------
1yr6A1          -------------------------
1zbsA1          -------------------------
2gujA1          -------------------------
1d8jA           -------------------------
1uouA3          GQRLRRGTPWLRVH-----------
1l1oA           -------------------------
1yvuA2          GRLY---------------------
1g8fA3          -------------------------
1tueA           -------------------------
1q3tA           TGLNIQEVVEKIKAEAEKR------
1w1wA           -------------------------
1e2hA           GGSWREDWGQLSGPRPHIGDTLF--
1o7d.2          EYLRAR-------------------
1iioA           -------------------------
1dwmA           DHGVVTS------------------
1ckeA           TLSIEQ-------------------
1v37A           -------------------------
1g31A           LTSLPVG------------------
1lnzA2          -------------------------
1e6vC           -------------------------
1oa8A           -------------------------
1upsA2          -------------------------
1tpzA           -------------------------