[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE39673.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1jwqA.bssp"
#ERROR : Can't open dsspfile "1xovA2.bssp"

## Summary of PDB Search
:441
    4e-38  34%  1jwqA  [c.56.5.6] N-ACETYLMURAMOYL-L-ALANINE AMIDASE CWLV
    2e-21  24%  1xovA2 [c.56.5.6] PLY PROTEIN A:1 -- 180
:441

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1jwqA           ----------------------------------------------------------------------
1xovA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1jwqA           ----------------------------------------------------------------------
1xovA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxV
1jwqA           ---------------------------------------------------------------------V
1xovA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IVLDPGHGGIDNGTQSQSGVSEKALVLEFALALRDQMEKGGKYRVVLTRTDDTFIPLNDRVKIARAHSAA
1jwqA           VVIDAGHGAKDSGAVGISKNYEKTFNLAMALKVESILKQNPKLEVVLTRSDDTFLELKQRVKVAENLKAN
1xovA2          --MSRGHSDKCVGAEDLSEIKEAEKVLNAASDEL--KREGHNVKTFIDRTSTTSANLNKIVNWHNANPAD


                         .         *         .         .         .         .         +:350
query           LFVSIHADALPRGEGDAQGATIYTLSDKASDAEAQRLADAENKADAIGGVNLTEEPTEVADILIDLAQRE
1jwqA           VFVSIHANS--SGSSASNGTETYYQRSA------------------------------------------
1xovA2          VHISVHLNA-----GKGTGVEVWYYAGDEK----------------------------------------


                         .         .         .         .         *         .         .:420
query           TKTFSNRFAQTLMREMKSATRLHKQPLKSAGFRVLKAPDVPSVLLELGYVSNKGDLKQLVSEQWRTKTVG
1jwqA           ----SKAFANVMHKYFAPATGLTDRGIRYGNFHVIRETTMPAVLLEVGYLSNAKEEATLFDEDFQNRVAQ
1xovA2          ----GRKLAVEISAKMAKALGLPNRGAKATKLRFLNSTKGTAVLLEVCFVDRKEDANAIHKSGMYDKLGI


                         .         .         +         .         .         .         .:490
query           AVALAIDSFFAKRxxxxxxxx
1jwqA           GIADGITEYLDVK--------
1xovA2          AIAEGL---------------