[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE39735.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bbuA2.bssp"
#ERROR : Can't open dsspfile "1wu7A2.bssp"
#ERROR : Can't open dsspfile "1n9wA2.bssp"
#ERROR : Can't open dsspfile "1adjA2.bssp"
#ERROR : Can't open dsspfile "1c0aA3.bssp"
#ERROR : Can't open dsspfile "1z7mA1.bssp"
#ERROR : Can't open dsspfile "1nnhA.bssp"
#ERROR : Can't open dsspfile "1b70A.bssp"
#ERROR : Can't open dsspfile "1n4kA1.bssp"
#ERROR : Can't open dsspfile "1asyA2.bssp"
#ERROR : Can't open dsspfile "1h4qA2.bssp"
#ERROR : Can't open dsspfile "2oceA5.bssp"
#ERROR : Can't open dsspfile "11asA.bssp"
#ERROR : Can't open dsspfile "2g9fA1.bssp"
#ERROR : Can't open dsspfile "1serA2.bssp"
#ERROR : Can't open dsspfile "1gc5A.bssp"
#ERROR : Can't open dsspfile "2btwA1.bssp"

## Summary of PDB Search
:351
    3e-45  28%  1bbuA2 [d.104.1.1] PROTEIN (LYSYL-TRNA SYNTHETASE) A:161 -- 502
    4e-22   9%  1wu7A2 [d.104.1.1] HISTIDYL-TRNA SYNTHETASE A:3 -- 329
    5e-17  15%  1n9wA2 [d.104.1.1] ASPARTYL-TRNA SYNTHETASE 2 A:111 -- 414
    6e-17  12%  1adjA2 [d.104.1.1] HISTIDYL-TRNA SYNTHETASE A:2 -- 325
    6e-17  18%  1c0aA3 [d.104.1.1] ASPARTYL TRNA SYNTHETASE A:107 -- 287 A:421 --
    3e-12   9%  1z7mA1 [d.104.1.1] ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT
    1e-10  22%  1nnhA  [d.104.1.1] ASPARAGINYL-TRNA SYNTHETASE-RELATED PEPTIDE
    8e-09  17%  1b70A  [d.104.1.1] PHENYLALANYL-TRNA SYNTHETASE
    3e-08  11%  1n4kA1 [a.118.22.1] INOSITOL 1,4,5-TRISPHOSPHATE RECEPTOR TYPE 1
    4e-08  22%  1asyA2 [d.104.1.1] ASPARTYL-TRNA SYNTHETASE A:205 -- 557
    2e-07  15%  1h4qA2 [d.104.1.1] PROLYL-TRNA SYNTHETASE A:5 -- 276
    3e-07  13%  2oceA5 [c.55.3.13] HYPOTHETICAL PROTEIN PA5201 A:325 -- 473
    2e-06  30%  11asA  [d.104.1.1] ASPARAGINE SYNTHETASE
    2e-06  13%  2g9fA1 [b.18.1.29] PEPTIDE N-GLYCANASE A:472 -- 651
    7e-05  10%  1serA2 [d.104.1.1] PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11))
    1e-04  12%  1gc5A  [c.72.1.3] ADP-DEPENDENT GLUCOKINASE
    7e-04  18%  2btwA1 [d.3.1.14] ALR0975 PROTEIN A:29 -- 238
:351

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxARYLDRKPFLRARSAVTXXXXXXXXXXXXXXVETAILQLSPGNETHLHAPRTEFKGP
1bbuA2          --------------RYLDSRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPG-----GAAARPFITH
1wu7A2          --------------EKIRFRDFYDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELVDKGGR
1n9wA2          ----------------------------------------------------------------------
1adjA2          ----------------------LRMHQRIVATARKVLEAAGALELVTPIFEETQVGAATDIVRKEMFTFQ
1c0aA3          -------------YRYLDRRPEMAQRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVHK-
1z7mA1          ----------------------VKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGQFIKHEG
1nnhA           ----------------------LDIQTKILEYMTDFFVKEGFKWLLPVIISWPDPAGEGMEPAEVEIYGV
1b70A           --------------------GGLHPITLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPEGP
1n4kA1          ----------------------SKVLGSIAGKLEKGTITQNERRSVTKLLEDLVYFVTGGTNSGQDVLEV
1asyA2          -------------YRVIDRTVTNQAQAGVCELFREYLATKKFTEVHTPKL------LGAPSEGGSSVFEV
1h4qA2          --------------------------------------------AYFPLFIPMSFLRFSPELAVVTHAGG
2oceA5          ----------------------------------------------------------------------
11asA           ----------------------------------------------------------------------
2g9fA1          ----------------------------------------------------KDWNMVYLARKEG-----
1serA2          ----------------------ALYELALLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVW
1gc5A           --------------------------------------------VQAPRENRFIANADDYN--------A
2btwA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DGELRTRFLRTSPEFACKKLLAAGEERIFEFARVFRDRERGRLHLPEFTMLEWYRAGEGYQTVXXXXXXX
1bbuA2          HNALLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
1wu7A2          EVTLIPEATPSTVRXVTSRKDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIAL
1n9wA2          ----------FTPPQLYKQIMVGVFERVYEVAP------------VEYLSLDVEMGFDLMRLEEALLAEM
1adjA2          DRGGRSLTLRPEGTAAMVRAYLEHGMRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVL
1c0aA3          ---GKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEAL
1z7mA1          QSITLRYDFTLPLVRLYSQIKDSTSARYSYFGKIFRKE-------KENYQIGIELFGESADKSELEILSL
1nnhA           KM-----RLTHSMILHKQLAIAMGLKKIFVLSPNIRLQKDDGRHAYEFTQLDFE----------------
1b70A           EGRLLLRTH-TSPMQVRYMVAHTPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIY
1n4kA1          NRERQKLMREQNILKQIFKLLQAPFTICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQK------------
1asyA2          TYFKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENNTHRHMTEFTGLDMEMAF-------------
1h4qA2          EELEEPLAVRPTSETVIGYMWSKWIRLLNQWGNVVRWRTRPFLRTSEFLWQEGHTA--------------
2oceA5          ----------------------------------------------------------------------
11asA           ----------------------------------------------------------------------
2g9fA1          -----SSFAYISWKFECGSAGLKVDTSIRTSSQSFESGSVRWKLRSETAQVNLLGDKNL-----------
1serA2          AIAETDLYLTGTAEVVLNALHSGEILRYAGYAPAFRSEAGSFGKDVRGLMRVHQFHKVEQ----------
1gc5A           RVYMRREFREGFEEITRNVELAIISKEYYPDGTTYKDVLDRVESHLNI----------------------
2btwA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXRTTGIGQFSFRGRTADPQAEPEMLTVAAAFARFAGIDLLATIIGGEGXXXXXXXXXXXXXXXXXX
1bbuA2          FRTLAQDLGKTEVTYGDVTLDFGKPFEKLTMREAIKKYRPETDMADL---DNFDSAKAIAESIGIHVEKS
1wu7A2          ASSILDRLGL-QDIYEIRINSRKIXEEIIGGXTSSDPFSVFSIID---------------RYHKISREEF
1n9wA2          LEEALNTAGDEIRLLGATWPSFPQDIPRLTHAEAKRILKEEL----------------------GYPVGQ
1adjA2          LYECLKELGLRRLKVKLSSVGPEDRARYNA-YLREVLSPHREALSED---------------------SK
1c0aA3          VRHLWLEVKGVDLGDFPVMTFAEAERRYGSDKPDLRDE-------------------------------S
1z7mA1          ALQVIEQLGLNKTVFEIGS---------AKFFQRLCQLASTELLTELL-----------------LKKDL
1nnhA           ----------------------------------------------------------------------
1b70A           ELAQALFGPDSKVRFQPVYFPFVEPGAQFAVWWPEGGKWLEL----------------------------
1n4kA1          ----------------------------------------------------------------------
1asyA2          ----------------------------------------------------------------------
1h4qA2          ----------------------------------------------------------------------
2oceA5          ----------------------------------------------------------------------
11asA           ----------------------------------------------------------------------
2g9fA1          ----------------------------------------------------------------------
1serA2          ----------------------------------------------------------------------
1gc5A           ----------------------------------------------------------------------
2btwA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XNWSDIFSKVLVDHIEPRLGEGRLTVLCEYPAPEAALARTKADDPRVAERFEVYACGVELANGFGELTDA
1bbuA2          WGLGRIVTEIFEEVAEAHLIQP--TFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDA
1wu7A2          VDQLRSAGIGEDGVSXIADLCSGTRGIDEXARITGKSSEEIARXAAVEDLLASYGVKNVRYDFSIVRGLS
1n9wA2          DLSEEAERLLGEYAKERWGS--DWLFVTRYPR-SVRPFYTYPEEDGTTRSFDLLFRGLEITSGGQRIHRY
1adjA2          ERLEENPMRILDSKSERD--QALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDY
1c0aA3          KWAPLWVIDFPMFEDDGEGGLTAMHHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNG
1z7mA1          SGLNAFIEKNNFSKELRGLLK--EIFITNELSRLENLVTNTKDDVL-ISSFDQLKEFSEKLSMIKPIIID
1nnhA           -----------------------------------------------------------LPYGYGEVASG
1b70A           ----------------GGAGMVHPKVFQAVDAYRERLGLPPAYRGVTGFAFGLGVELAMLRYGIPDIRYF
1n4kA1          ----------------------------------------------------------------------
1asyA2          --------------------------LDKFPLEIRPFYMPDPANPKYSNSYDFFMRGEEILSGAQRIHDH
1h4qA2          ----------------------------------------------------------------------
2oceA5          --------------------------------SEAGASVYSASELAAKEFPELDVSLRGAVSIARRLQDP
11asA           --------------------------------------------------------AFELSSM-GIRVDA
2g9fA1          ----------------------------------------------------------------------
1serA2          ----------------------------------------------------------------------
1gc5A           ----------------------------------------------------------------------
2btwA1          ---------------------------QERGGHISPLAAYNEQTDRFVSRYKYPPVWVKTTDLWKAXVDS


                         .         *         .         .         .         .         +:350
query           AEQRLRFTASMDEKERRYGERYPLDEDFLAAVGRMPEASGVALGFDRLVMLAAGAMRIDQVVWTPPADEA
1bbuA2          EDQAQRFLDQVAAKDAGDDEAMFYDEDYVTALEHLPPTAGLGIGIDRMVMLFTNSHTIRDVILFP-----
1wu7A2          YYTGIVFEAYDRSGQFRAILGGGRYDNLALXSGESVPAVGFGXGDAVISLLLKRE---------------
1n9wA2          EELLESLKAKGMDPE-------AFHGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYAR--------
1adjA2          YVRTAFEVHHEEIGAQSALGGGGRYDGLSELLGPRVPGVGFAFGVERVALALEAE---------------
1c0aA3          DMQQTVFGILGINEEE----QREKFGFLLDALYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFP-----
1z7mA1          LGMVPKMMFKAYSSAANQPILSGGRYDQLLSNQEEAFAIGFCCHMDTILKALERQ---------------
1nnhA           GEREWEY-----EKIVAKIRKAGLNEDEIAKAGKLKPSAGAGIGVERLVRFIVGAKHIAEVQ--------
1b70A           FGGRLKF-------LEQFKGVL------------------------------------------------
1n4kA1          ----------------------------------------------------------------------
1asyA2          ALLQERMKAHGLSPE---DPGL---KDYCDGFSGCPPHAGGGIGLERVVMFYLDLKNIRRASLFP-----
1h4qA2          ----------------------------------------------------------------------
2oceA5          LAELVKIEPKSIGVG-------------------------------------------------------
11asA           DTLKHQLALTGDEDR----LELEWHQALLR--GEMPQTIGGGIGQSRLTMLLLQLPHIGQVVWPAAVRES
2g9fA1          ----------------------------------------------------------------------
1serA2          ----------------------------------------------------------------------
1gc5A           ----------------------------------------------------------------------
2btwA1          VSQKTR----------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           x
1bbuA2          -
1wu7A2          -
1n9wA2          -
1adjA2          -
1c0aA3          -
1z7mA1          -
1nnhA           -
1b70A           -
1n4kA1          -
1asyA2          -
1h4qA2          -
2oceA5          -
11asA           -
2g9fA1          -
1serA2          -
1gc5A           -
2btwA1          -