[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE39945.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1jr3A2.bssp"
#ERROR : Can't open dsspfile "1a5tA2.bssp"
#ERROR : Can't open dsspfile "2fug11.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"

## Summary of PDB Search
:346
    1e-25  28%  1jr3A2 [c.37.1.20] DNA POLYMERASE III SUBUNIT GAMMA A:3 -- 242
    4e-11  28%  1a5tA2 [c.37.1.20] DELTA PRIME A:1 -- 207
    2e-05  11%  2fug11 [a.29.12.1] NADH-QUINONE OXIDOREDUCTASE CHAIN 1 1:334 -- 438
    3e-04  22%  1eg7A  [c.37.1.10] FORMYLTETRAHYDROFOLATE SYNTHETASE
:346

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxPRETTALFGHHVAEQALLDAYRGGRIAHAWLIGGAQGIGKATLAYRMARFVLAHRD
1jr3A2          --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
1a5tA2          --------------------YPWLRPDFEKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQP
2fug11          ----------------------------------------------------------------------
1eg7A           --------------------------VYRRLKDKPDGKLILVTAITPTPAGEGKTTTSVGLTDA------


                         .         .         *         .         .         .         .:140
query           PLADAVQGAASLDLDPSHPVVRHVAAEAHGGLLTLERSVNDKGVLRNVITVDESRETIGFFGSTAAVEGW
1jr3A2          ITATPVCDNCREIEQGRFVDLIEIDAASRTK-------------------VEDTRDLLDNVQYAPARGRF
1a5tA2          QGHKSCGHCRGCQLMQAGTHPDYYTLAPEKGKNTLGVD-------AVREVTEKLNEHARLGGA-------
2fug11          ----------------------------------------------------------------------
1eg7A           -LARLGKRVMVCLREPSLGPSFGIKGGAAGG---------------------------------------


                         +         .         .         .         .         *         .:210
query           RVCIVDTVDDLNASSANALLKVIEEPPQRSLFLLISNSPARVLPTIQSRCRKLMLRPxxxxxxxxxxxxx
1jr3A2          KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLKA-------------
1a5tA2          KVVWVTDAALLTDAAANALLKTLEEPPAETWFFLATREPERLLATLRSRCRLHYLAP-------------
2fug11          ----------LADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLW------------------------
1eg7A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1jr3A2          ----------------------------------------------------------------------
1a5tA2          ----------------------------------------------------------------------
2fug11          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1jr3A2          ------------------------------------------------------------------
1a5tA2          ------------------------------------------------------------------
2fug11          ------------------------------------------------------------------
1eg7A           ------------------------------------------------------------------