[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE40040.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ni4A.bssp"
#ERROR : Can't open dsspfile "1dtwA.bssp"
#ERROR : Can't open dsspfile "1l8aA1.bssp"
#ERROR : Can't open dsspfile "1um9A.bssp"
#ERROR : Can't open dsspfile "1b0pA2.bssp"
#ERROR : Can't open dsspfile "1c7sA2.bssp"
#ERROR : Can't open dsspfile "1upaA3.bssp"
#ERROR : Can't open dsspfile "1ovmA3.bssp"
#ERROR : Can't open dsspfile "1powA3.bssp"
#ERROR : Can't open dsspfile "1powA2.bssp"
#ERROR : Can't open dsspfile "1zpdA3.bssp"
#ERROR : Can't open dsspfile "1bfdA3.bssp"
#ERROR : Can't open dsspfile "2c31A3.bssp"
#ERROR : Can't open dsspfile "1ozfA3.bssp"
#ERROR : Can't open dsspfile "1ay0A1.bssp"

## Summary of PDB Search
:344
    2e-58  46%  1ni4A  [c.36.1.11] PYRUVATE DEHYDROGENASE E1 COMPONENT: ALPHA
    8e-54  27%  1dtwA  [c.36.1.11] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
    1e-46   9%  1l8aA1 [c.36.1.10] PYRUVATE DEHYDROGENASE E1 COMPONENT A:56 -- 470
    6e-41  28%  1um9A  [c.36.1.11] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT
    2e-35   9%  1b0pA2 [c.36.1.12] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    1e-23  11%  1c7sA2 [b.2.2.3] BETA-N-ACETYLHEXOSAMINIDASE A:28 -- 200
    5e-22  10%  1upaA3 [c.36.1.9] CARBOXYETHYLARGININE SYNTHASE A:375 -- 572
    7e-21  14%  1ovmA3 [c.36.1.9] INDOLE-3-PYRUVATE DECARBOXYLASE A:356 -- 551
    1e-20  15%  1powA3 [c.36.1.9] PYRUVATE OXIDASE A:366 -- 593
    3e-20  12%  1powA2 [c.36.1.5] PYRUVATE OXIDASE A:9 -- 182
    4e-18  16%  1zpdA3 [c.36.1.9] PYRUVATE DECARBOXYLASE A:363 -- 566
    4e-16  13%  1bfdA3 [c.36.1.9] BENZOYLFORMATE DECARBOXYLASE A:342 -- 524
    4e-15  19%  2c31A3 [c.36.1.9] OXALYL-COA DECARBOXYLASE A:370 -- 552
    6e-15  21%  1ozfA3 [c.36.1.9] ACETOLACTATE SYNTHASE, CATABOLIC A:367 -- 554
    5e-14  21%  1ay0A1 [c.36.1.10] TRANSKETOLASE A:3 -- 337
:344

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxETGQDRNSGPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQE
1ni4A           ----------CDLHRLEEGPPVT--TVLTREDGLKYYRXXQTVRRXELKADQLYKQKIIRGFCHLCDGQE
1dtwA           -------------------------PHLPKEKVLKLYKSMTLLNTMDRILYESQRQG-RISFYMTNYGEE
1l8aA1          ----------------NTIPVEEQPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLELGGHMASFQSSA
1um9A           -------------------WLGDFPLDLEGEKLRRLYRDMLAARMLDERYTILIR-TGKTSFIAPAAGHE
1b0pA2          ---------------------------------NATGCSSIWGASAPSMPYKTNRLGQGPAWGN-SLFED
1c7sA2          ----------------------------------------------------------------------
1upaA3          ----------------------------------------------------------------------
1ovmA3          ------------------------------------------------------------------LTQE
1powA3          ----------------------------------------------------------------------
1powA2          ----------------------------------------------------------------------
1zpdA3          ----------------------------------------------------------------------
1bfdA3          ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------------
1ay0A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AVVVGMQMALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGI
1ni4A           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTGRKGGCAKGKGGSXHXYA--KNFYGGNGI
1dtwA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
1l8aA1          TIYDVCFNHFFRARNVYFQGHISPGVYARAFLEGRLTQEQLDNFRQEVHGNGLSSYPHPMPEFWQFPTVS
1um9A           AAQVAIAHAIRPGFDWVFYYRDHGLALALGIPLKELLGQMLATKADPNKGRQMPEHPGSKALNFFTVASP
1b0pA2          AAEYGFGMNMSMFARRTHLADLAAKALESDASGDVKEALQGWLAGKNDPIKSKEYGDK----LKKLLAGQ
1c7sA2          ------------------------------------------------------KLNVKMLDNRAGENGV
1upaA3          ------------RVHQVI-DSXNTVXEEAAEPGEGTIVSDIGFFRHYGV------LFARADQPFGFLTSA
1ovmA3          NFWRTLQTFIRPGDIILADQGTSAFGAIDLRLPAD------------------------VNFIVQPLWGS
1powA3          -------------------------------------------------------LTPSNRHITSNLFAT
1powA2          ------------------------------------------------------NSIMDALSAERDRIHY
1zpdA3          -------------------------------------------------------LPNGARVEYEMQWGH
1bfdA3          -------------------VDQDAGRLH-PETVFDTLNDMAPENAIYLNESTSTTAQMWQRLNMRNPGSY
2c31A3          ------------------------------------------------------DMLKPRKRLDSGTWGV
1ozfA3          --------------------------------------------------------------MISNGQQT
1ay0A1          -------------------------------------------------------HPEFELPGVEVTTGP


                         +         .         .         .         .         *         .:210
query           VGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYAMGTSVTRS
1ni4A           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNXAALWKLPCIFICENNRYGXGTSVERA
1dtwA           LATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
1l8aA1          MGLGPIGAIYQAKFLKYLEHKQTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVNCNLQRLGPVTGNG
1um9A           IASHVPPAAGAAISMKLLRTGQVAVCTFGDGATSEGDWYAGINFAAVQGAPAVFIAENNFPTIAD-----
1b0pA2          KDGLLGQIAAMSDLYTKK----SVWIFGGDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSK
1c7sA2          DCA--------ALGADWASCNRVLFTLSNDGQAIDGKDWVIYFHS----PRQTLRVDNDQFKIAHLTGDL
1upaA3          GCSSFGYGIPAAIGAQXARPDQPTFLIAGDGGFHSN--SSDLETIARLNLPIVTVVVNNDTNRSHDPAVK
1ovmA3          IGYTLAAAFGAQTACPNR----RVIVLTGDGAA-QLTIQELGSMLRDKQHPIILVLNNEGYTVERAIHGA
1powA3          MGVGIPGAIAAKLNYPER----QVFNLAGDGGA--SMTMQDLATQVQYHLPVINVVFTNCQYQNDFIGVE
1powA2          IQVRHEEVGAMAAAAKLTGKIGVCFGSAGPGGTH---LMNGLYDAREDHVPVLALIGQF----GTTGMNM
1zpdA3          IGWSVPAAFGYAVGAPER----RNILMVGDGSFQLT--AQEVAQMVRLKLPVIIFLNNYGYTIEVMIHDG
1bfdA3          YFCAAGLGFALAIGVQLAEPERQVIAVIGDGSANYS--ISALWTAAQYNIPTIFVIMNNGTEAENVPGLD
2c31A3          MGIGMGYCVAAAAVTGKP-----VIAVEGDS--AFGFSGMELETICRYNLPVTVIIMNNGGIPGVISCTR
1ozfA3          MGVALPWAIGAWLVNPER----KVVSVSGDGG--FLQSSMELETAVRLKANVLHLIVDNGYNMVAIQEEK
1ay0A1          LGQGISNAVGMAMAQANSDNYTYVF--LGDGCLQEGISSEASSLAGHLKLNLIAIYDDNKITIDGA-TSI


                         .         .         .         +         .         .         .:280
query           SAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQTYRYRGHSMSDPAKYRTRE
1ni4A           AASTDYYKRG--DFIPGLRVDGXDILCVREATRFAAAYCRSGKGPILXELQTYRYHGHSXSDGVSYRTRE
1dtwA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSS-----
1l8aA1          KIINELEGIFEGAGWNVIKVWGSRWDELLRKDTSGKNETVDGDYQTFKSKDGAYVREHFFGKYPETAALV
1um9A           --------KAHAFGIPGYLVDGMDVLASYYVVKEAVERARRGEGPSLVELRVYRYGPHRKKDPIPFRRFL
1b0pA2          ATPTGAVAKFAAAGKRYVYVATVSMGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGMGKSQDVM
1c7sA2          YKLEAKFSGFPAGKAVEIPVVAEYWQLFRND-FLPRWYATSGDAKPKMLANTDTENLDQFVAPFTKRTKD
1upaA3          FGGVDFVALAEANGVDATRATNRE------ELLAALRKGAELGRPFLIEVPVNYDFQPGGFGA-------
1ovmA3          EQRYNDIAQALSLDPQSECWRVSEAEQLA----DVLEKVAHHERLSLIEVMLPKADIPPLLGALTKALEA
1powA3          FNDIDFSKIADGVHMQAFRVNKIE--QLPDVFEQAKAIAQ--HEPVLIDAVITGSAMSSAADIEAFKQRY
1powA2          DTFQEMNENPIYADVADYNVTAVNAATLPHVIDEAIRRAYAHQGVAVVQIPV--DLPWQQIPAEDW----
1zpdA3          PYNWDYAGLMEVFNGNGGYDSGLKAKTGGELAEAIKVALANTDGPTLIECFIGREDCT----EELVKWGK
1bfdA3          VPGIDFRALAKGYGVQA--LKADNLEQLK----GSLQEALSAKGPVLIEVST------------------
2c31A3          LTRGRYDMMMEAFGGKGYVANTP--AELKAALEEAVAS----GKPCLINAMIDPDAG-------------
1ozfA3          KYQMDFKAYAESFGAKGFAVESAE------ALEPTLRAAMDVDGPAVVAIPVDYRDNPL-----------
1ay0A1          SFDEDVAKRYEAYGWEVLYVENEDLAGIAKAIAQAKL---SKDKPTLIKMTTTIGYGSLHAGSHSPLKAD


                         .         *         .         .         .         .         +:350
query           EVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKIDAEVRKIVNEAADFAQNDPEPDPSELYTDVYx
1ni4A           EIQEVRSKSDPIXLLKDRXVNSNLSVEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
1dtwA           -AYRHPISRLRHYLLSQGW----WDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVY-
1l8aA1          ADWTDEQIWALNRGGHDPKKIYA-AFKKAQETKGKATVILAHIKGYGMGDAAMDGVRHIRDRF-
1um9A           EARGLWNEE---------------WEEDVRE---EIRAELERGLKEAEEAGPVPPEWMFEDVF-
1b0pA2          NT-AVKSGYWPLFRYDPRLAAQGKPFQLDSKAPDGSVEEFLMAQNRFAVLDRSFPED-------
1c7sA2          DKNILM---TPAS---------------------------------------------------
1upaA3          ----------------------------------------------------------------
1ovmA3          ----------------------------------------------------------------
1powA3          EAQDLQPLSTYLKQ--------------------------------------------------
1powA2          ----------------------------------------------------------------
1zpdA3          RVAAAN-SRKPVNK--------------------------------------------------
1bfdA3          ----------------------------------------------------------------
2c31A3          ----------------------------------------------------------------
1ozfA3          ----------------------------------------------------------------
1ay0A1          DVKQLK----------------------------------------------------------