[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rpal2:ABE40088.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2i10A1.bssp"
#ERROR : Can't open dsspfile "2oi8A1.bssp"
#ERROR : Can't open dsspfile "2g7sA1.bssp"
#ERROR : Can't open dsspfile "2np5A1.bssp"
#ERROR : Can't open dsspfile "1z77A1.bssp"
#ERROR : Can't open dsspfile "2np3B1.bssp"
#ERROR : Can't open dsspfile "2fq4A1.bssp"
#ERROR : Can't open dsspfile "2g3bA1.bssp"
#ERROR : Can't open dsspfile "2fd5A1.bssp"
#ERROR : Can't open dsspfile "1zk8A1.bssp"
#ERROR : Can't open dsspfile "3c07A1.bssp"
#ERROR : Can't open dsspfile "1pb6A1.bssp"
#ERROR : Can't open dsspfile "1v7bA1.bssp"
#ERROR : Can't open dsspfile "2fbqA1.bssp"
#ERROR : Can't open dsspfile "2g7lA1.bssp"
#ERROR : Can't open dsspfile "1t56A1.bssp"
#ERROR : Can't open dsspfile "1rktA1.bssp"
#ERROR : Can't open dsspfile "1ui5A1.bssp"
#ERROR : Can't open dsspfile "2hyjA1.bssp"
#ERROR : Can't open dsspfile "1vi0A1.bssp"
#ERROR : Can't open dsspfile "2genA1.bssp"
#ERROR : Can't open dsspfile "1sgmA1.bssp"
#ERROR : Can't open dsspfile "2iu5A1.bssp"
#ERROR : Can't open dsspfile "1jt0A1.bssp"
#ERROR : Can't open dsspfile "1a6iA1.bssp"
#ERROR : Can't open dsspfile "2hkuA1.bssp"
#ERROR : Can't open dsspfile "2o7tA1.bssp"
#ERROR : Can't open dsspfile "2g7gA1.bssp"
#ERROR : Can't open dsspfile "2id3A1.bssp"
#ERROR : Can't open dsspfile "1t33A1.bssp"
#ERROR : Can't open dsspfile "2d6yA1.bssp"

## Summary of PDB Search
:217
    1e-11  28%  2i10A1 [a.4.1.9] PUTATIVE TETR TRANSCRIPTIONAL REGULATOR A:10 -- 78
    2e-11  25%  2oi8A1 [a.4.1.9] PUTATIVE REGULATORY PROTEIN SCO4313 A:8 -- 86
    2e-10  29%  2g7sA1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR, TETR FAMILY A:3 -- 76
    2e-10  15%  2np5A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR A:9 -- 77
    4e-10  23%  1z77A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR (TETR FAMILY) A:1 --
    5e-10  19%  2np3B1 [a.4.1.9] PUTATIVE TETR-FAMILY REGULATOR B:35 -- 99
    8e-10  19%  2fq4A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR, TETR FAMILY A:9 -- 77
    1e-09  23%  2g3bA1 [a.4.1.9] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR A:2
    1e-09  24%  2fd5A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR A:1 -- 76
    2e-09  15%  1zk8A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR, TETR FAMILY A:6 -- 77
    3e-09  23%  3c07A1 [a.4.1.9] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    4e-09  21%  1pb6A1 [a.4.1.9] HYPOTHETICAL TRANSCRIPTIONAL REGULATOR YCDC A:14
    4e-09  20%  1v7bA1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR A:1 -- 74
    4e-09  19%  2fbqA1 [a.4.1.9] PROBABLE TRANSCRIPTIONAL REGULATOR A:2 -- 80
    4e-09  22%  2g7lA1 [a.4.1.9] TETR-FAMILY TRANSCRIPTIONAL REGULATOR A:16 -- 83
    5e-09  22%  1t56A1 [a.4.1.9] ETHR REPRESSOR A:22 -- 94
    5e-09  27%  1rktA1 [a.4.1.9] PROTEIN YFIR A:2 -- 82
    5e-09  25%  1ui5A1 [a.4.1.9] A-FACTOR RECEPTOR HOMOLOG A:5 -- 75
    6e-09  18%  2hyjA1 [a.4.1.9] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR A:8
    7e-09  16%  1vi0A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR A:6 -- 77
    7e-09  18%  2genA1 [a.4.1.9] PROBABLE TRANSCRIPTIONAL REGULATOR A:6 -- 75
    1e-08  19%  1sgmA1 [a.4.1.9] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR YXAF
    1e-08  16%  2iu5A1 [a.4.1.9] HYPOTHETICAL PROTEIN YCEG A:1 -- 71
    2e-08  26%  1jt0A1 [a.4.1.9] HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA
    2e-08  18%  1a6iA1 [a.4.1.9] TETRACYCLINE REPRESSOR PROTEIN CLASS D A:2 -- 67
    6e-08  12%  2hkuA1 [a.4.1.9] A PUTATIVE TRANSCRIPTIONAL REGULATOR A:18 -- 87
    2e-06  21%  2o7tA1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR A:1 -- 78
    4e-06  20%  2g7gA1 [a.4.1.9] RHA04620, PUTATIVE TRANSCRIPTIONAL REGULATOR A:9
    5e-05  16%  2id3A1 [a.4.1.9] PUTATIVE TRANSCRIPTIONAL REGULATOR A:13 -- 80
    6e-05  21%  1t33A1 [a.4.1.9] PUTATIVE TRANSCRIPTIONAL REPRESSOR (TETR/ACRR A:1
    1e-04  13%  2d6yA1 [a.4.1.9] PUTATIVE TETR FAMILY REGULATORY PROTEIN A:7 -- 74
:217

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxSDTRMPRPKLHSDDDILDTAQLVLLRQGPSHFTLSDVAKAVGISRA
2i10A1          -------------------------------------QVALQTAXELFWRQGYEGTSITDLTKALGINPP
2oi8A1          --------------------------TPRERYRTQVRAEIKDHAWEQIATAGASALSLNAIAKRXGXSGP
2g7sA1          -------------------------------------DDILQCARTLIIRGGYNSFSYADISQVVGIRNA
2np5A1          -------------------------------------ERLAAALFDVAAESGLEGASVREVAKRAGVSIG
1z77A1          -------------------------------------DAILKAAVEVFGKKGYDRATTDEIAEKAGVAKG
2np3B1          ---------------------------------------ILTAARVCFAERGFDATSLRRIAETAGVDQS
2fq4A1          -------------------------------------KAILSASYELLLESGFKAVTVDKIAERAKVSKA
2g3bA1          -------------------------------------DAILKASATAIAQRGIRGLRVNDVAEVAGVSPG
2fd5A1          ----------------------------MSDKKTQTRARILGAATQALLERGAVEPSVGEVMGAAGLTVG
1zk8A1          -------------------------------------QKIVETAAEIADANGVQEVTLASLAQTLGVRSP
3c07A1          -------------------------------------ALILETAXRLFQERGYDRTTXRAIAQEAGVSVG
1pb6A1          ---------------------------------------ILSAALDTFSQFGFHGTRLEQIAELAGVSKT
1v7bA1          -------------------------------------EMILRTAIDYIGEYSLETLSYDSLAEATGLSKS
2fbqA1          -------------------------------------ERILDAAEQLFAEKGFAETSLRLITSKAGVNLA
2g7lA1          -------------------------------------RWIVDTAVALXRAEGLEKVTXRRLAQELDTGPA
1t56A1          -------------------------------------LAILATAENLLEDRPLADISVDDLAKGAGISRP
1rktA1          ------------------------SPKVTKEHKDKRQAEILEAAKTVFKRKGFELTTXKDVVEESGFSRG
1ui5A1          -------------------------------------ATIIGAAADLFDRRGYESTTLSEIVAHAGVTKG
2hyjA1          -------------------------------------GRILGRAAEIASEEGLDGITIGRLAEELEMSKS
1vi0A1          ---------------------------------------IIDAAVEVIAENGYHQSQVSKIAKQAGVADG
2genA1          -------------------------------------DEILQAALACFSEHGVDATTIEXIRDRSGASIG
1sgmA1          -------------------------------------EKILHTASRLSQLQGYHATGLNQIVKESGAPKG
2iu5A1          ----------------------------MEKSII-TQKIIAKAFKDLMQSNAYHQISVSDIMQTAKIRRQ
1jt0A1          -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
1a6iA1          -------------------------------------SKVINSALELLNEVGIEGLTTRKLAQKLGVEQP
2hkuA1          -------------------------------------DALFTAATELFLEHGE-GVPITQICAAAGAHPN
2o7tA1          -------------------------------------EHIITTTCNLYRTHHHDSLTXENIAEQAGVGVA
2g7gA1          -------------------------------------ERIAEAALELVDRDG--DFRXPDLARHLNVQVS
2id3A1          ---------------------------------------VLLAAGDALAADGFDALDLGEIARRAGVGKT
1t33A1          ---------------------------------------LIAAALAQFGEYGL-HATTRDIAALAGQNIA
2d6yA1          -------------------------------------ARIFEAAVAEFARHGIAGARIDRIAAEARANKQ


                         .         .         *         .         .         .         .:140
query           ALIQRFTDKATLQRRIMERMTQEVRDYFDAAPSHTGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2i10A1          SLYAAFGSKRDLFEKTLDRYXCERTLQLEEA---------------------------------------
2oi8A1          ALYRYFDGRDELITELIRDAYRSQADSLRAAA--------------------------------------
2g7sA1          SIHHHFPSKSDLVCKLVSQYRQEAEAGIAE----------------------------------------
2np5A1          AVQHHFSTKDEXFAFALRTLVDKLLARLSEVE--------------------------------------
1z77A1          LIFHYFKNKEELYYQAYXSVTEKLQKEFE-----------------------------------------
2np3B1          LVHHFYGTKENLFLQALELPGKIEEAITAAAQ--------------------------------------
2fq4A1          TIYKWWPNKAAVVXDGFLSAAAARLPVPD-----------------------------------------
2g3bA1          LLYYHFKDRIGLLEAALNYINDRARAYRSEGE--------------------------------------
2fd5A1          GFYAHFQSKDALMLEAFEQLLGKRRE--------------------------------------------
1zk8A1          SLYNHVKGLQDVRKNLGIYGIKKLHNRLEEAAE-------------------------------------
3c07A1          NAYYYFAGKEHLIQGFYDRIAAEHRAAVREV---------------------------------------
1pb6A1          NLLYYFPSKEALYIAVLRQILDIWLAPLKAF---------------------------------------
1v7bA1          GLIYHFPSRHALLLGMHELLADDWDKELRDIT--------------------------------------
2fbqA1          AVNYHFGSKKALIQAVFSRFLGPFCASLEKELDRRQ----------------------------------
2g7lA1          SLYVYVANTAELHAAVLDALLGEVD---------------------------------------------
1t56A1          TFYFYFPSKEAVLLTLLDRVVNQADMALQTLAEN------------------------------------
1rktA1          GVYLYFSSTEEXFRRIIETGLDEGLRKLDKS---------------------------------------
1ui5A1          ALYFHFAAKEDLAHAILEIQSRTSRRLAKD----------------------------------------
2hyjA1          GVHKHFGTKETLQISTLDKAFVDFWHRVVEPA--------------------------------------
1vi0A1          TIYLYFKNKEDILISLFKEKXGQFIERXEEDIKEKA----------------------------------
2genA1          SLYHHFGNKERIHGELYLAGIGQYAALLEAGFAR------------------------------------
1sgmA1          SLYHFFPNGEELAIEAVTYTGKIVEHLIQQSMDES-----------------------------------
2iu5A1          TFYNYFQNQEELLSWIFENDFAELIN--------------------------------------------
1jt0A1          NLYYHFKTKENLFLEIL-----------------------------------------------------
1a6iA1          TLYWHVKNKRALLDALAVEILARHHDY-------------------------------------------
2hkuA1          QVTYYYGSKERLFVEVACAAVLRAGKRAEDDAA-------------------------------------
2o7tA1          TLYRNFPDRFTLDXACAQYLFNVV----------------------------------------------
2g7gA1          SIYHHAKGRAAVVELVRHRV---VREIDGSA---------------------------------------
2id3A1          TVYRRWGTPGGLAADLLADXAEQSLP--------------------------------------------
1t33A1          AITYYFGSKEDLYLACAQWIADFLGEKFRPH---------------------------------------
2d6yA1          LIYAYYGNKGELFASVLEKKXLDLAISVPV----------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2i10A1          ----------------------------------------------------------------------
2oi8A1          ----------------------------------------------------------------------
2g7sA1          ----------------------------------------------------------------------
2np5A1          ----------------------------------------------------------------------
1z77A1          ----------------------------------------------------------------------
2np3B1          ----------------------------------------------------------------------
2fq4A1          ----------------------------------------------------------------------
2g3bA1          ----------------------------------------------------------------------
2fd5A1          ----------------------------------------------------------------------
1zk8A1          ----------------------------------------------------------------------
3c07A1          ----------------------------------------------------------------------
1pb6A1          ----------------------------------------------------------------------
1v7bA1          ----------------------------------------------------------------------
2fbqA1          ----------------------------------------------------------------------
2g7lA1          ----------------------------------------------------------------------
1t56A1          ----------------------------------------------------------------------
1rktA1          ----------------------------------------------------------------------
1ui5A1          ----------------------------------------------------------------------
2hyjA1          ----------------------------------------------------------------------
1vi0A1          ----------------------------------------------------------------------
2genA1          ----------------------------------------------------------------------
1sgmA1          ----------------------------------------------------------------------
2iu5A1          ----------------------------------------------------------------------
1jt0A1          ----------------------------------------------------------------------
1a6iA1          ----------------------------------------------------------------------
2hkuA1          ----------------------------------------------------------------------
2o7tA1          ----------------------------------------------------------------------
2g7gA1          ----------------------------------------------------------------------
2id3A1          ----------------------------------------------------------------------
1t33A1          ----------------------------------------------------------------------
2d6yA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxx
2i10A1          -------
2oi8A1          -------
2g7sA1          -------
2np5A1          -------
1z77A1          -------
2np3B1          -------
2fq4A1          -------
2g3bA1          -------
2fd5A1          -------
1zk8A1          -------
3c07A1          -------
1pb6A1          -------
1v7bA1          -------
2fbqA1          -------
2g7lA1          -------
1t56A1          -------
1rktA1          -------
1ui5A1          -------
2hyjA1          -------
1vi0A1          -------
2genA1          -------
1sgmA1          -------
2iu5A1          -------
1jt0A1          -------
1a6iA1          -------
2hkuA1          -------
2o7tA1          -------
2g7gA1          -------
2id3A1          -------
1t33A1          -------
2d6yA1          -------