[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF65947.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dsxA.bssp"
#ERROR : Can't open dsspfile "1s24A.bssp"
#ERROR : Can't open dsspfile "1brfA.bssp"
#ERROR : Can't open dsspfile "1bq8A.bssp"
#ERROR : Can't open dsspfile "2pyaA.bssp"
#ERROR : Can't open dsspfile "1yk4A.bssp"
#ERROR : Can't open dsspfile "6rxnA.bssp"
#ERROR : Can't open dsspfile "1h7vA.bssp"
#ERROR : Can't open dsspfile "1dx8A.bssp"
#ERROR : Can't open dsspfile "1yk5A.bssp"
#ERROR : Can't open dsspfile "1m2yA.bssp"
#ERROR : Can't open dsspfile "1iu5A.bssp"
#ERROR : Can't open dsspfile "1yk5C.bssp"
#ERROR : Can't open dsspfile "4rxnA.bssp"
#ERROR : Can't open dsspfile "2pveA.bssp"
#ERROR : Can't open dsspfile "7rxnA.bssp"
#ERROR : Can't open dsspfile "1rb9A.bssp"
#ERROR : Can't open dsspfile "2pvxB.bssp"
#ERROR : Can't open dsspfile "1b2jA.bssp"
#ERROR : Can't open dsspfile "1bfyA.bssp"
#ERROR : Can't open dsspfile "1b2oA.bssp"
#ERROR : Can't open dsspfile "1t9pA.bssp"
#ERROR : Can't open dsspfile "1smmA.bssp"
#ERROR : Can't open dsspfile "2pvxA.bssp"
#ERROR : Can't open dsspfile "1b13A.bssp"
#ERROR : Can't open dsspfile "2rdvA.bssp"
#ERROR : Can't open dsspfile "1fhhA.bssp"
#ERROR : Can't open dsspfile "1c09A.bssp"
#ERROR : Can't open dsspfile "1t9qA.bssp"
#ERROR : Can't open dsspfile "1t9oA.bssp"
#ERROR : Can't open dsspfile "1be7A.bssp"
#ERROR : Can't open dsspfile "2v3bB.bssp"
#ERROR : Can't open dsspfile "2kn9A.bssp"
#ERROR : Can't open dsspfile "1spwA.bssp"
#ERROR : Can't open dsspfile "1qcvA.bssp"

## Summary of PDB Search
:353
    2e-10  55%  2dsxA  [g.41.5 (1e8jA)] RUBREDOXIN
    9e-10  41%  1s24A  [g.41.5] RUBREDOXIN 2
    9e-10  43%  1brfA  [g.41.5] PROTEIN (RUBREDOXIN)
    9e-10  43%  1bq8A  [g.41.5] PROTEIN (RUBREDOXIN)
    2e-09  43%  2pyaA  [x.x.x] RUBREDOXIN
    2e-09  43%  1yk4A  [x.x.x] RUBREDOXIN
    2e-09  65%  6rxnA  [x.x.x] RUBREDOXIN
    2e-09  42%  1h7vA  [g.41.5] RUBREDOXIN
    2e-09  42%  1dx8A  [g.41.5] RUBREDOXIN
    3e-09  42%  1yk5A  [x.x.x] RUBREDOXIN
    3e-09  43%  1m2yA  [g.41.5 (1rwdA)] RUBREDOXIN
    3e-09  43%  1iu5A  [g.41.5] RUBREDOXIN
    5e-09  43%  1yk5C  [x.x.x] RUBREDOXIN
    5e-09  41%  4rxnA  [x.x.x] RUBREDOXIN
    6e-09  43%  2pveA  [x.x.x] RUBREDOXIN
    1e-08  50%  7rxnA  [g.41.5 (8rxnA)] RUBREDOXIN
    1e-08  50%  1rb9A  [x.x.x] RUBREDOXIN
    1e-08  41%  2pvxB  [x.x.x] RUBREDOXIN
    1e-08  39%  1b2jA  [g.41.5] PROTEIN (RUBREDOXIN)
    2e-08  39%  1bfyA  [x.x.x] RUBREDOXIN
    2e-08  39%  1b2oA  [g.41.5] PROTEIN (RUBREDOXIN)
    2e-08  39%  1t9pA  [g.41.5] RUBREDOXIN
    2e-08  39%  1smmA  [g.41.5] RUBREDOXIN
    2e-08  45%  2pvxA  [x.x.x] RUBREDOXIN
    2e-08  39%  1b13A  [g.41.5] PROTEIN (RUBREDOXIN)
    4e-08  45%  2rdvA  [g.41.5] RUBREDOXIN
    7e-08  38%  1fhhA  [g.41.5] RUBREDOXIN
    7e-08  38%  1c09A  [g.41.5] RUBREDOXIN
    9e-08  38%  1t9qA  [g.41.5] RUBREDOXIN
    1e-07  38%  1t9oA  [g.41.5] RUBREDOXIN
    2e-07  37%  1be7A  [x.x.x] RUBREDOXIN
    9e-07  37%  2v3bB  [x.x.x] RUBREDOXIN 2
    8e-06  34%  2kn9A  [x.x.x] RUBREDOXIN
    1e-05  61%  1spwA  [x.x.x] RUBREDOXIN
    2e-05  35%  1qcvA  [g.41.5] PROTEIN (RUBREDOXIN VARIANT PFRD-XC4)
:353

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2dsxA           ----------------------------------------------------------------------
1s24A           ----------------------------------------------------------------------
1brfA           ----------------------------------------------------------------------
1bq8A           ----------------------------------------------------------------------
2pyaA           ----------------------------------------------------------------------
1yk4A           ----------------------------------------------------------------------
6rxnA           ----------------------------------------------------------------------
1h7vA           ----------------------------------------------------------------------
1dx8A           ----------------------------------------------------------------------
1yk5A           ----------------------------------------------------------------------
1m2yA           ----------------------------------------------------------------------
1iu5A           ----------------------------------------------------------------------
1yk5C           ----------------------------------------------------------------------
4rxnA           ----------------------------------------------------------------------
2pveA           ----------------------------------------------------------------------
7rxnA           ----------------------------------------------------------------------
1rb9A           ----------------------------------------------------------------------
2pvxB           ----------------------------------------------------------------------
1b2jA           ----------------------------------------------------------------------
1bfyA           ----------------------------------------------------------------------
1b2oA           ----------------------------------------------------------------------
1t9pA           ----------------------------------------------------------------------
1smmA           ----------------------------------------------------------------------
2pvxA           ----------------------------------------------------------------------
1b13A           ----------------------------------------------------------------------
2rdvA           ----------------------------------------------------------------------
1fhhA           ----------------------------------------------------------------------
1c09A           ----------------------------------------------------------------------
1t9qA           ----------------------------------------------------------------------
1t9oA           ----------------------------------------------------------------------
1be7A           ----------------------------------------------------------------------
2v3bB           ----------------------------------------------------------------------
2kn9A           ----------------------------------------------------------------------
1spwA           ----------------------------------------------------------------------
1qcvA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2dsxA           ----------------------------------------------------------------------
1s24A           ----------------------------------------------------------------------
1brfA           ----------------------------------------------------------------------
1bq8A           ----------------------------------------------------------------------
2pyaA           ----------------------------------------------------------------------
1yk4A           ----------------------------------------------------------------------
6rxnA           ----------------------------------------------------------------------
1h7vA           ----------------------------------------------------------------------
1dx8A           ----------------------------------------------------------------------
1yk5A           ----------------------------------------------------------------------
1m2yA           ----------------------------------------------------------------------
1iu5A           ----------------------------------------------------------------------
1yk5C           ----------------------------------------------------------------------
4rxnA           ----------------------------------------------------------------------
2pveA           ----------------------------------------------------------------------
7rxnA           ----------------------------------------------------------------------
1rb9A           ----------------------------------------------------------------------
2pvxB           ----------------------------------------------------------------------
1b2jA           ----------------------------------------------------------------------
1bfyA           ----------------------------------------------------------------------
1b2oA           ----------------------------------------------------------------------
1t9pA           ----------------------------------------------------------------------
1smmA           ----------------------------------------------------------------------
2pvxA           ----------------------------------------------------------------------
1b13A           ----------------------------------------------------------------------
2rdvA           ----------------------------------------------------------------------
1fhhA           ----------------------------------------------------------------------
1c09A           ----------------------------------------------------------------------
1t9qA           ----------------------------------------------------------------------
1t9oA           ----------------------------------------------------------------------
1be7A           ----------------------------------------------------------------------
2v3bB           ----------------------------------------------------------------------
2kn9A           ----------------------------------------------------------------------
1spwA           ----------------------------------------------------------------------
1qcvA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2dsxA           ----------------------------------------------------------------------
1s24A           ----------------------------------------------------------------------
1brfA           ----------------------------------------------------------------------
1bq8A           ----------------------------------------------------------------------
2pyaA           ----------------------------------------------------------------------
1yk4A           ----------------------------------------------------------------------
6rxnA           ----------------------------------------------------------------------
1h7vA           ----------------------------------------------------------------------
1dx8A           ----------------------------------------------------------------------
1yk5A           ----------------------------------------------------------------------
1m2yA           ----------------------------------------------------------------------
1iu5A           ----------------------------------------------------------------------
1yk5C           ----------------------------------------------------------------------
4rxnA           ----------------------------------------------------------------------
2pveA           ----------------------------------------------------------------------
7rxnA           ----------------------------------------------------------------------
1rb9A           ----------------------------------------------------------------------
2pvxB           ----------------------------------------------------------------------
1b2jA           ----------------------------------------------------------------------
1bfyA           ----------------------------------------------------------------------
1b2oA           ----------------------------------------------------------------------
1t9pA           ----------------------------------------------------------------------
1smmA           ----------------------------------------------------------------------
2pvxA           ----------------------------------------------------------------------
1b13A           ----------------------------------------------------------------------
2rdvA           ----------------------------------------------------------------------
1fhhA           ----------------------------------------------------------------------
1c09A           ----------------------------------------------------------------------
1t9qA           ----------------------------------------------------------------------
1t9oA           ----------------------------------------------------------------------
1be7A           ----------------------------------------------------------------------
2v3bB           ----------------------------------------------------------------------
2kn9A           ----------------------------------------------------------------------
1spwA           ----------------------------------------------------------------------
1qcvA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTLE
2dsxA           ----------------------------------------------------------------------
1s24A           ----------------------------------------------------------------------
1brfA           ----------------------------------------------------------------------
1bq8A           ----------------------------------------------------------------------
2pyaA           ----------------------------------------------------------------------
1yk4A           ----------------------------------------------------------------------
6rxnA           ----------------------------------------------------------------------
1h7vA           ----------------------------------------------------------------------
1dx8A           ----------------------------------------------------------------------
1yk5A           ----------------------------------------------------------------------
1m2yA           ----------------------------------------------------------------------
1iu5A           ----------------------------------------------------------------------
1yk5C           ----------------------------------------------------------------------
4rxnA           ----------------------------------------------------------------------
2pveA           ----------------------------------------------------------------------
7rxnA           ----------------------------------------------------------------------
1rb9A           ----------------------------------------------------------------------
2pvxB           ----------------------------------------------------------------------
1b2jA           ----------------------------------------------------------------------
1bfyA           ----------------------------------------------------------------------
1b2oA           ----------------------------------------------------------------------
1t9pA           ----------------------------------------------------------------------
1smmA           ----------------------------------------------------------------------
2pvxA           ----------------------------------------------------------------------
1b13A           ----------------------------------------------------------------------
2rdvA           ----------------------------------------------------------------------
1fhhA           ----------------------------------------------------------------------
1c09A           ----------------------------------------------------------------------
1t9qA           ----------------------------------------------------------------------
1t9oA           ----------------------------------------------------------------------
1be7A           ----------------------------------------------------------------------
2v3bB           ----------------------------------------------------------------------
2kn9A           -------------------------------------------------------------------TLE
1spwA           ----------------------------------------------------------------------
1qcvA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           WLKEYPVTENEPVVRMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDExxxx
2dsxA           -----------------CTVCGYEYDPAKGDPDSGIKPGTKFEDLPDDWACPVCGASKDAF---------
1s24A           -----------------CITCGHIYDEALGDEAEGFTPGTRFEDIPDDWCCPDCGATKEDYVLYEE----
1brfA           -----------------CKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED----
1bq8A           -----------------CKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED----
2pyaA           --------------KLSCKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGSPKSEFERIE-----
1yk4A           --------------KLSCKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGAPKSEFERIE-----
6rxnA           -----------------CNVCGYEYDPAEHDNV-------PFDQLPDDWCCPVCGVSKDQF---------
1h7vA           --------------KYECEACGYIYEPEKGDKFAGIPPGTPFVDLSDSFMCPACRSPKNQFKSI------
1dx8A           --------------KYECEACGYIYEPEKGDKFAGIPPGTPFVDLSDSFMCPACRSPKNQFKSI------
1yk5A           ------------MAKWRCKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGAPKSEFERIE-----
1m2yA           -----------------CKICGYIYDEDAGDPDNGVSPGTKFEEIPDDWVCPICGAPKSEF---------
1iu5A           -----------------CKICGYIYDEDAGDPDNGVSPGTKFEEIPDDWVCPICGAPKSEF---------
1yk5C           --------------KWRCKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGAPKSEFERIE-----
4rxnA           -----------------CTVCGYIYDPEDGDPDDGVNPGTDFKDIPDDWVCPLCGVGKDEFEEVEE----
2pveA           -----------------CKICGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPICGAPKSEF---------
7rxnA           -----------------CTVCGYEYDPAEGDPDNGVKPGTSFDDLPADWVCPVCGAPKSEF---------
1rb9A           -----------------CTVCGYEYDPAEGDPDNGVKPGTSFDDLPADWVCPVCGAPKSEF---------
2pvxB           -----------------CTVCGYIYDEDAGDPDNGISPGTKFEELPDDWVCPLCGVGKDQFEKLED----
1b2jA           -----------------CTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE----
1bfyA           -----------------CTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE----
1b2oA           -----------------CTVCVYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE----
1t9pA           -----------------CTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGAPKDQFEEVEE----
1smmA           -----------------CTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPACGVGKDQFEEVEE----
2pvxA           -----------------CTVCGYIYDEDAGDPDNGISPGTKFEELPDDWVCPLCGVGKDQF---------
1b13A           -----------------CTVCAYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE----
2rdvA           -----------------CTVCGYEYDPAEGDPDNGVKPGTAFEDVPADWVCPICGAPKSEF---------
1fhhA           -----------------CTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVE-----
1c09A           -----------------CTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGAGKDQFEEVE-----
1t9qA           -----------------CTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGLGKDQFEEVE-----
1t9oA           -----------------CTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGGGKDQFEEVE-----
1be7A           -----------------CTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLSGVGKDQFEEVEE----
2v3bB           --------------KWQCVVCGFIYDEALGLPEEGIPAGTRWEDIPADWVCPDCGVGKIDFEMIE-----
2kn9A           AQTQGPGSMNDYKL-FRCIQCGFEYDEALGWPEDGIAAGTRWDDIPDDWSCPDCGAAKSDFEMVE-----
1spwA           -----------------CTVCGYEYDPA-------------FEDLPDDWACPVCGASKDAF---------
1qcvA           ------------------KITGYIYDEDAGDPDNGISPGTKFEELPDDWVAPITGAPKSEFEKLED----


                         .         .         .         .         *         .         .:420
query           xxx
2dsxA           ---
1s24A           ---
1brfA           ---
1bq8A           ---
2pyaA           ---
1yk4A           ---
6rxnA           ---
1h7vA           ---
1dx8A           ---
1yk5A           ---
1m2yA           ---
1iu5A           ---
1yk5C           ---
4rxnA           ---
2pveA           ---
7rxnA           ---
1rb9A           ---
2pvxB           ---
1b2jA           ---
1bfyA           ---
1b2oA           ---
1t9pA           ---
1smmA           ---
2pvxA           ---
1b13A           ---
2rdvA           ---
1fhhA           ---
1c09A           ---
1t9qA           ---
1t9oA           ---
1be7A           ---
2v3bB           ---
2kn9A           ---
1spwA           ---
1qcvA           ---