[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:fdnH

[Show Plain Result]

#ERROR : Can't open dsspfile "1kqfB.bssp"
#ERROR : Can't open dsspfile "1h0hB.bssp"
#ERROR : Can't open dsspfile "2ivfB.bssp"
#ERROR : Can't open dsspfile "1y4zB.bssp"
#ERROR : Can't open dsspfile "1siwB.bssp"
#ERROR : Can't open dsspfile "1r27B.bssp"
#ERROR : Can't open dsspfile "1q16B.bssp"
#ERROR : Can't open dsspfile "2vpyB.bssp"
#ERROR : Can't open dsspfile "1ti2B.bssp"
#ERROR : Can't open dsspfile "2fug9.bssp"
#ERROR : Can't open dsspfile "3c7bB.bssp"
#ERROR : Can't open dsspfile "1h98A.bssp"

## Summary of PDB Search
:294
    e-166  93%  1kqfB  [d.58.1 - f.23.22] FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE,
    1e-32  34%  1h0hB  [d.58.1] FORMATE DEHYDROGENASE (SMALL SUBUNIT)
    1e-14  33%  2ivfB  [x.x.x] ETHYLBENZENE DEHYDROGENASE BETA-SUBUNIT
    9e-14  35%  1y4zB  [x.x.x] RESPIRATORY NITRATE REDUCTASE 1 BETA CHAIN
    9e-14  35%  1siwB  [d.58.1] RESPIRATORY NITRATE REDUCTASE 1 BETA CHAIN
    9e-14  35%  1r27B  [d.58.1] RESPIRATORY NITRATE REDUCTASE 1 BETA CHAIN
    9e-14  35%  1q16B  [d.58.1] RESPIRATORY NITRATE REDUCTASE 1 BETA CHAIN
    2e-12  37%  2vpyB  [x.x.x] NRFC PROTEIN
    5e-12  26%  1ti2B  [d.58.1 - b.3.5] PYROGALLOL HYDROXYTRANSFERASE SMALL SUBUNIT
    2e-04  44%  2fug9  [x.x.x] NADH-QUINONE OXIDOREDUCTASE CHAIN 9
    5e-04  31%  3c7bB  [x.x.x] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    6e-04  33%  1h98A  [d.58.1] FERREDOXIN
:294

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSMETQDIIKRSATNAITPPPQARDYKAEVAKLIDVSSCVGCKACQVACSEWNDIRDNVGHCVGVYDNPA
1kqfB           -AMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPA
1h0hB           ---------------------------------VDTTRCTACRGCQVACKQWHGNPATPTENTGFHQNPP
2ivfB           ----------------------------------------------------------------------
1y4zB           ----------------------------------------------------------------------
1siwB           ----------------------------------------------------------------------
1r27B           ----------------------------------------------------------------------
1q16B           ----------------------------------------------------------------------
2vpyB           ----------------------------------------------------------------------
1ti2B           --------------------------------VIDVAKCQDCNNCFMGCMDEHELNEWPGYTASMQ----
2fug9           ----------------------------------------------------------------------
3c7bB           ----------------------------------------------------------------------
1h98A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DLSAKSWTVMRFTETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSEHCIGCGYCI
1kqfB           DLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCI
1h0hB           DFNFHTYKLVRMHEQEIDGRIDWLFFPDQCRHCIAPPCKATADESAIIHDDATGCVLFKTKDLEDYESVI
2ivfB           -----------------------------CNHCTNPACLAACPTGAIYKREDNGIVLVDQERCKGHRHCV
1y4zB           -----------------------------CEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCI
1siwB           -----------------------------CEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCI
1r27B           -----------------------------CEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCI
1q16B           -----------------------------CEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCI
2vpyB           -------------------------RPEQCLHCENPPCVPVCPT-GASYQTKDGLVLVDPKKXXXXXXXX
1ti2B           --RGHRWMNIERRERGTYPRNDINYRPTPCMHCENAPCV--AKGNGAVYQREDGIVLIDPEKAKGKKELL
2fug9           -----------------------------------------------LTRHPNGL-----EKCIGCSLCA
3c7bB           --------------------------------CEIPSTVAACPTGALKPDMKNKTIKVDVEKCMYCGNCY
1h98A           -----------------------------CIGVKDQSCVEVCPVE--CIYDGGDQFYIHPEECIDCGACV


                         +         .         .         .         .         *         .:210
query           AGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELGEQRVEKLKARGFEH
1kqfB           AGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELAEQRVAKLKARGYEH
1h0hB           SACPYDVPRKVAESNQMAKCDMCIDRITNGLRPACVTSCPTGAMNFGDLSEMEAMASARLAEIKA-AYSD
2ivfB           EACPYKAIYFNPVSQTSEKCILCYPRIEKGIANACNRQCPGRVRAFGYLDDTTSHVHKLVKKWK------
1y4zB           TGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCSETC-------------------------------
1siwB           TGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCSETC-------------------------------
1r27B           TGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCSETC-------------------------------
1q16B           TGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCSETC-------------------------------
2vpyB           XXXPYDARYLHPA-GYVSKCTFCAHRLEKGKVPACVETCPTYCRTFG-----------------------
1ti2B           DTCPYGVMYWNEEENVAQKCTMCADESWAPKMPRCAHNCGSFVYEF-----LKTTPEAMAKKVEEEGLE-
2fug9           AACPYVEPAENDPENKVYRCIFC---------GLCEEACPTGAIVLGYDFEMAD----------------
3c7bB           TMCP-GMPLFDPEND-------------------------------------------------------
1h98A           PACPVN----------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AGIYNPQGVGGTHVMYVLHHANQPELYHGLPKDPQIDTSINLWKGALKPLAAAGFIATFAGLIYHYIGIG
1kqfB           AGVYNPEGVGGTHVMYVLHHADQPELYHGLPKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIG
1h0hB           AKLCDPDDV---RVIFLTAH--NPKLYH------------------------------------------
2ivfB           ----------------------------------------------------------------------
1y4zB           ----------------------------------------------------------------------
1siwB           ----------------------------------------------------------------------
1r27B           ----------------------------------------------------------------------
1q16B           ----------------------------------------------------------------------
2vpyB           ----------------------------------------------------------------------
1ti2B           ----------------------------------------------------------------------
2fug9           ----------------------------------------------------------------------
3c7bB           ----------------------------------------------------------------------
1h98A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PNKxxxxxxxxxxx
1kqfB           PNK-----------
1h0hB           --------------
2ivfB           --------------
1y4zB           --------------
1siwB           --------------
1r27B           --------------
1q16B           --------------
2vpyB           --------------
1ti2B           --------------
2fug9           --------------
3c7bB           --------------
1h98A           --------------