[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF66348.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e3jA.bssp"
#ERROR : Can't open dsspfile "2dq4A.bssp"
#ERROR : Can't open dsspfile "1pl8A.bssp"
#ERROR : Can't open dsspfile "2dfvA.bssp"
#ERROR : Can't open dsspfile "3gfbA.bssp"
#ERROR : Can't open dsspfile "1pl6A.bssp"
#ERROR : Can't open dsspfile "2d8aA.bssp"
#ERROR : Can't open dsspfile "2eerB.bssp"
#ERROR : Can't open dsspfile "2eerA.bssp"
#ERROR : Can't open dsspfile "3ip1C.bssp"
#ERROR : Can't open dsspfile "3ip1A.bssp"
#ERROR : Can't open dsspfile "3i4cH.bssp"
#ERROR : Can't open dsspfile "1rjwA.bssp"
#ERROR : Can't open dsspfile "3i4cA.bssp"
#ERROR : Can't open dsspfile "1h2bB.bssp"
#ERROR : Can't open dsspfile "1h2bA.bssp"
#ERROR : Can't open dsspfile "1vj0D.bssp"
#ERROR : Can't open dsspfile "1vj0B.bssp"
#ERROR : Can't open dsspfile "1vj0A.bssp"
#ERROR : Can't open dsspfile "1lluA.bssp"
#ERROR : Can't open dsspfile "1r37A.bssp"
#ERROR : Can't open dsspfile "1ntoA.bssp"
#ERROR : Can't open dsspfile "3i4cD.bssp"
#ERROR : Can't open dsspfile "3i4cE.bssp"
#ERROR : Can't open dsspfile "3i4cB.bssp"
#ERROR : Can't open dsspfile "1jvbA.bssp"
#ERROR : Can't open dsspfile "1hdzA.bssp"
#ERROR : Can't open dsspfile "1htbA.bssp"
#ERROR : Can't open dsspfile "3i4cC.bssp"
#ERROR : Can't open dsspfile "1ee2A.bssp"
#ERROR : Can't open dsspfile "1u3uA.bssp"
#ERROR : Can't open dsspfile "1hdyA.bssp"
#ERROR : Can't open dsspfile "2eihA.bssp"
#ERROR : Can't open dsspfile "1hsoA.bssp"
#ERROR : Can't open dsspfile "2h6eA.bssp"
#ERROR : Can't open dsspfile "1qlhA.bssp"
#ERROR : Can't open dsspfile "1n8kA.bssp"
#ERROR : Can't open dsspfile "1p0fA.bssp"
#ERROR : Can't open dsspfile "1mgoA.bssp"
#ERROR : Can't open dsspfile "1d1tA.bssp"
#ERROR : Can't open dsspfile "1d1sA.bssp"
#ERROR : Can't open dsspfile "1ju9A.bssp"
#ERROR : Can't open dsspfile "1hetA.bssp"
#ERROR : Can't open dsspfile "1axeA.bssp"
#ERROR : Can't open dsspfile "1axgA.bssp"
#ERROR : Can't open dsspfile "1a71A.bssp"
#ERROR : Can't open dsspfile "2dphA.bssp"
#ERROR : Can't open dsspfile "1uufA.bssp"
#ERROR : Can't open dsspfile "2fzeA.bssp"
#ERROR : Can't open dsspfile "1f8fA.bssp"
#ERROR : Can't open dsspfile "1qv6A.bssp"
#ERROR : Can't open dsspfile "1piwA.bssp"
#ERROR : Can't open dsspfile "2fzwA.bssp"
#ERROR : Can't open dsspfile "1u3wA.bssp"
#ERROR : Can't open dsspfile "1cdoA.bssp"
#ERROR : Can't open dsspfile "3cosD.bssp"
#ERROR : Can't open dsspfile "3cosA.bssp"
#ERROR : Can't open dsspfile "1kolA.bssp"
#ERROR : Can't open dsspfile "1e3lB.bssp"
#ERROR : Can't open dsspfile "1e3lA.bssp"
#ERROR : Can't open dsspfile "1e3eB.bssp"
#ERROR : Can't open dsspfile "1e3eA.bssp"
#ERROR : Can't open dsspfile "2cd9B.bssp"
#ERROR : Can't open dsspfile "1yb5A.bssp"
#ERROR : Can't open dsspfile "2cdbB.bssp"
#ERROR : Can't open dsspfile "2cdaB.bssp"
#ERROR : Can't open dsspfile "2cd9A.bssp"
#ERROR : Can't open dsspfile "2cdbC.bssp"
#ERROR : Can't open dsspfile "2cdbA.bssp"
#ERROR : Can't open dsspfile "2cdaA.bssp"
#ERROR : Can't open dsspfile "1yqdA.bssp"
#ERROR : Can't open dsspfile "2hcyA.bssp"
#ERROR : Can't open dsspfile "3fbgA.bssp"
#ERROR : Can't open dsspfile "2b5wA.bssp"
#ERROR : Can't open dsspfile "2b5vA.bssp"
#ERROR : Can't open dsspfile "2ouiA.bssp"
#ERROR : Can't open dsspfile "3fbgB.bssp"
#ERROR : Can't open dsspfile "2vwgA.bssp"
#ERROR : Can't open dsspfile "1y9aA.bssp"
#ERROR : Can't open dsspfile "2c0cB.bssp"
#ERROR : Can't open dsspfile "2c0cA.bssp"
#ERROR : Can't open dsspfile "1tt7A.bssp"
#ERROR : Can't open dsspfile "3gazB.bssp"
#ERROR : Can't open dsspfile "3gazA.bssp"
#ERROR : Can't open dsspfile "3gmsA.bssp"

## Summary of PDB Search
:339
    3e-38  30%  1e3jA  [b.35.1 - c.2.1] NADP(H)-DEPENDENT KETOSE REDUCTASE
    1e-37  32%  2dq4A  [x.x.x] L-THREONINE 3-DEHYDROGENASE
    6e-33  28%  1pl8A  [b.35.1 - c.2.1] HUMAN SORBITOL DEHYDROGENASE
    2e-31  33%  2dfvA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    4e-30  31%  3gfbA  [x.x.x] L-THREONINE 3-DEHYDROGENASE
    8e-27  29%  1pl6A  [b.35.1 - c.2.1] SORBITOL DEHYDROGENASE
    3e-26  33%  2d8aA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    2e-25  29%  2eerB  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    2e-25  29%  2eerA  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    1e-24  38%  3ip1C  [x.x.x] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
    1e-24  38%  3ip1A  [x.x.x] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
    8e-21  37%  3i4cH  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    1e-20  32%  1rjwA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    2e-19  37%  3i4cA  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    5e-19  27%  1h2bB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    5e-19  27%  1h2bA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    6e-19  33%  1vj0D  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
    6e-19  33%  1vj0B  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
    6e-19  33%  1vj0A  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
    8e-19  26%  1lluA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    2e-18  37%  1r37A  [b.35.1 - c.2.1] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    2e-18  37%  1ntoA  [b.35.1 - c.2.1] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    2e-18  37%  3i4cD  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    4e-18  39%  3i4cE  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    1e-17  41%  3i4cB  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    3e-17  36%  1jvbA  [b.35.1 - c.2.1] NAD(H)-DEPENDENT ALCOHOL DEHYDROGENASE
    6e-17  29%  1hdzA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    1e-16  29%  1htbA  [b.35.1 - c.2.1] BETA3 ALCOHOL DEHYDROGENASE
    2e-16  38%  3i4cC  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    4e-16  27%  1ee2A  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    5e-16  28%  1u3uA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE BETA CHAIN
    5e-16  28%  1hdyA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    5e-16  27%  2eihA  [x.x.x] ALCOHOL DEHYDROGENASE
    1e-15  26%  1hsoA  [b.35.1 - c.2.1] CLASS I ALCOHOL DEHYDROGENASE 1, ALPHA
    2e-15  28%  2h6eA  [x.x.x] D-ARABINOSE 1-DEHYDROGENASE
    9e-15  27%  1qlhA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    9e-15  27%  1n8kA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE E CHAIN
    2e-14  36%  1p0fA  [b.35.1 - c.2.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    2e-14  27%  1mgoA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE E CHAIN
    2e-14  24%  1d1tA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
    2e-14  24%  1d1sA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
    3e-14  27%  1ju9A  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    3e-14  27%  1hetA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE E CHAIN
    3e-14  27%  1axeA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    6e-14  27%  1axgA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    6e-14  27%  1a71A  [b.35.1 - c.2.1] LIVER ALCOHOL DEHYDROGENASE
    8e-14  32%  2dphA  [x.x.x] FORMALDEHYDE DISMUTASE
    1e-13  37%  1uufA  [b.35.1 - c.2.1] ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN
    1e-13  28%  2fzeA  [b.35.1 - c.2.1 (1m6hA)] ALCOHOL DEHYDROGENASE CLASS III CHI
    1e-13  31%  1f8fA  [b.35.1 - c.2.1] BENZYL ALCOHOL DEHYDROGENASE
    1e-13  27%  1qv6A  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE E CHAIN
    2e-13  36%  1piwA  [b.35.1 - c.2.1] HYPOTHETICAL ZINC-TYPE ALCOHOL
    8e-13  27%  2fzwA  [x.x.x] ALCOHOL DEHYDROGENASE CLASS III CHI CHAIN
    2e-12  34%  1u3wA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE GAMMA CHAIN
    2e-11  33%  1cdoA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    4e-11  26%  3cosD  [x.x.x] ALCOHOL DEHYDROGENASE 4
    4e-11  26%  3cosA  [x.x.x] ALCOHOL DEHYDROGENASE 4
    6e-11  35%  1kolA  [b.35.1 - c.2.1] FORMALDEHYDE DEHYDROGENASE
    8e-11  27%  1e3lB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    8e-11  27%  1e3lA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    8e-11  27%  1e3eB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    8e-11  27%  1e3eA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    1e-10  28%  2cd9B  [x.x.x] GLUCOSE DEHYDROGENASE
    9e-10  27%  1yb5A  [b.35.1 - c.2.1] QUINONE OXIDOREDUCTASE
    1e-09  28%  2cdbB  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    1e-09  28%  2cdaB  [x.x.x] GLUCOSE DEHYDROGENASE
    1e-09  28%  2cd9A  [x.x.x] GLUCOSE DEHYDROGENASE
    2e-09  28%  2cdbC  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    3e-09  28%  2cdbA  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    3e-09  28%  2cdaA  [x.x.x] GLUCOSE DEHYDROGENASE
    6e-09  30%  1yqdA  [x.x.x] SINAPYL ALCOHOL DEHYDROGENASE
    7e-09  28%  2hcyA  [x.x.x] ALCOHOL DEHYDROGENASE 1
    1e-08  30%  3fbgA  [x.x.x] PUTATIVE ARGINATE LYASE
    1e-08  24%  2b5wA  [x.x.x] GLUCOSE DEHYDROGENASE
    6e-08  23%  2b5vA  [x.x.x] GLUCOSE DEHYDROGENASE
    1e-07  22%  2ouiA  [x.x.x] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    2e-07  28%  3fbgB  [x.x.x] PUTATIVE ARGINATE LYASE
    3e-07  24%  2vwgA  [x.x.x] GLUCOSE DEHYDROGENASE
    7e-07  23%  1y9aA  [x.x.x] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    9e-07  26%  2c0cB  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    9e-07  26%  2c0cA  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    6e-06  41%  1tt7A  [b.35.1 - c.2.1] YHFP
    6e-06  32%  3gazB  [x.x.x] ALCOHOL DEHYDROGENASE SUPERFAMILY PROTEIN
    6e-06  32%  3gazA  [x.x.x] ALCOHOL DEHYDROGENASE SUPERFAMILY PROTEIN
    6e-05  34%  3gmsA  [x.x.x] PUTATIVE NADPH:QUINONE REDUCTASE
:339

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKSIVIEKPNTLTIETRALPQPAPGEVRIKVKLAGICGSDSHIYRGHNPFAKYPRVIGHEFFGVIDAVGD
1e3jA           --SAVLYKQNDLRLEQRPIPEPKEDEVLLQMAYVGICGSDVHYYE-HGRIADFPMVIGHEASGTVVKVGK
2dq4A           -----------LTLVDRPVPEPGPGEILVRVEAASICGTDLHIWKWDRGRIRPPLVTGHEFSGVVEAVGP
1pl8A           --SLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWRIGNFIVKKPMVLGHEASGTVEKVGS
2dfvA           ------------------VPKPGPGEVLIKVLATSICGTDLHIYEW-NEWAQSPPQIGHXXXXXXXXXXX
3gfbA           ------------------VPKPGPGEVLIKVLATSICGTDLHIYEW-NEWAKPPQIMXXXXXXXXXXXXX
1pl6A           --SLVVHGPGDLRLENYPIPEPGPNEVLLRHSV-GICGSDVHYWRIGNFIVKKP-VLGHEASGTVEKVGS
2d8aA           ------------------VPKPGPGEVLIKVLATSICGTDLHIYE-WNEWAQKPPQIGHXXXXXXXXXXX
2eerB           MRLVEIGKP--LKLEDIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRDLGVKLPVTLGHEIAGRIEEVGD
2eerA           MRLVEIGKP--LKLEDIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRDLGVKLPVTLGHEIAGRIEEVGD
3ip1C           -----------------------PTEIIIKVKACGICGSDVHAQTDEEGYILYPGLLGHEFSGVVVEAGP
3ip1A           -----------------------PTEIIIKVKACGICGSDVHAQTDEEGYILYPGLLGHEFSGVVVEAGP
3i4cH           ----LVEIGKPLSLQEIGVPKPKGPQVLIKVEAAGVCHSDVHMRQGRFGNVKLPVTLGHEIAGKIEEVGD
1rjwA           MKAAVVEQKEPLKIKEVEKPTISYGEVLVRIKACGVCHTDLHAAHGDWPVKKLPLXXXXXXXXXXXXXXX
3i4cA           MRAVRLVEP--LSLQEIGVPKPKGPQVLIKVEAAGVCHSDVHMRQGRDLGVKLPVTLGHEIAGKIEEVGD
1h2bB           -------------------------DVIVRIAGAGVCHTDLHLVQGHELLQKLPYTLGHENVGYIEEVAE
1h2bA           -------------------------DVIVRIAGAGVCHTDLHLVQGHELLQKLPYTLGHENVGYIEEVAE
1vj0D           --AMVLEKFNQLVYKEFEISDIPRGSILVEILSAGVCGSDVHMFRGEDPRVPLPIILGHEGAGVVEVNGE
1vj0B           --AMVLEKFNQLVYKEFEISDIPRGSILVEILSAGVCGSDVHMFRGEDPRVPLPIILGHEGAGVVEVNGE
1vj0A           --AMVLEKFNQLVYKEFEISDIPRGSILVEILSAGVCGSDVHMFRGEDPRVPLPIILGHEGAGVVEVNGE
1lluA           MKAAVVHAYGALRIEEVKVPLPGPGQVLVKIEASGVCHTDLHAAEGDWPVPPLPFIPGHEXXXXXXXXXX
1r37A           ----LVEIGKPLSLQEIGVPKPKGPQVLIKVEAAGVCHSDVHMRQGRDLGVKLPVTLGHEIAGKIEEVGD
1ntoA           ----LVEIGKPLSLQEIGVPKPKGPQVLIKVEAAGVCHSDVHMRQGRDLGVKLPVTLGHEIAGKIEEVGD
3i4cD           -----------LSLQEIGVPKPKGPQVLIKVEAAGVCHSDVHMRIVEDLGVKLPVTLGHEIAGKIEEVGE
3i4cE           -----------LSLQEIGVPKPKGPQVLIKVEAAGVCHSDVHM-------RQLPVTLGHEIAGKIEEVGD
3i4cB           ------------------VPKPKGPQVLIKVEAAGVCHSDVHM--------RLPVTLGHEIAGKIEEVGD
1jvbA           ----LVEIGKPLSLQEIGVPKPKGPQVLIKVEAAGVCHSDVHRQGRFGNLVKLPVTLGHEIAGKIEEVGD
1hdzA           -----VKKP--FSIEDVEVAPPKAYEVRIKMVAVGICGTDDHVVSG-NLVTPLPVILGHEAAGIVESVGE
1htbA           -----VKKP--FSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSG-NLVTPLPVILGHEAAGIVESVGE
3i4cC           ----LVEIGKPLSLQEIGVPKPKGPQVLIKVEAAGVCHSDT---------------LGHEIAGKIEEVGD
1ee2A           --AVLWEQKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDDHVVSG-TLVAPLPVIAGHEAAGIVESIGE
1u3uA           -----VKKP--FSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSG-NLVTPLPVILGHEAAGIVESVGE
1hdyA           -----VKKP--FSIEDVEVAPPKAYEVRIKMVAVGICHTDDHVVSG-NLVTPLPVILGHEAAGIVESVGE
2eihA           MRAVVMRAPEVLEVADLPVPEPGPKEVRVRLKAAALNHLDVWVRKGASPKLPLPHXXXXXXXXXXXXXXX
1hsoA           --AVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTDDHVVSG-TMVTPLPVILGHEAAGIVESVGE
2h6eA           ------------------IPEPQGEEVLIRIGGAGVCRTDLRVWKGVEAKQGFPIILGHENAGTIVEVGE
1qlhA           --AVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSG-TLVTPLPVIAGHEAAGIVESIGE
1n8kA           --AVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSG-TLVTPLPVIAGHEAAGIVESIGE
1p0fA           --AVAWEPHKPLSLETITVAPPKAHEVRIKILASGICGSDSSVLKEIIP-SKFPVILGHEAVGVVESIGA
1mgoA           --AVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSG-TLVTPLPVIAGHEAAGIVESIGE
1d1tA           --AVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKG-TMVSKFPVIVGHEATGIVESIGE
1d1sA           --AVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKG-TMVSKFPVIVGHEATGIVESIGE
1ju9A           --AVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSG-TLVTPLPVIAGHEAAGIVESIGE
1hetA           --AVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSG-TLVTPLPVIAGHEAAGIVESIGE
1axeA           --AVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSG-TLVTPLPVIAGHEAAGIVESIGE
1axgA           --AVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSG-TLVTPLPVIAGHEAAGIVESIGE
1a71A           --AVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSG-TLVTPLPVIAGHEAAGIVESIGE
2dphA           -KSVVYHGTRDLRVETVPYPKLEHNNVILKVVSTNICGSDQHIYRGRFIVPK-GHVLGHEITGEVVEKGS
1uufA           --------------------EPGPNDVKIEIAYCGVCHSDLHQVRSEWAGTVYPCVPGHEIVGRVVAVGD
2fzeA           --AVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHEGAGIVESVGE
1f8fA           -------------LQALKIRQPQGDEVLVKVVATGMCHTDL-IVRDQKYPVPLPAVLGHEGSGIIEAIGP
1qv6A           --AVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDQVVSG-TLVTPLPVIAGHEAAGIVESIGE
1piwA           -------------------------DIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGP
2fzwA           --AVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHLGAGIVESVGE
1u3wA           --AVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSG-NLVTPLPVILGHEAAGIVESVGE
1cdoA           --AVAWEANKPLVIEEIEVDVPHANEIRIKIIATGVCHTDLHLFEGKHKDG-FPVVLGHEGAGIVESVGP
3cosD           --AIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLAFPVIVGHEAAGIVESIGP
3cosA           --AIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLAFPVIVGHEAAGIVESIGP
1kolA           --------------------------VILKVVSTNICGSDQHMVRGRTT-AQVGLVLGHEITGEVIEKGR
1e3lB           -----------LCIEEIEVSPPKACEVRIQVIATCVCHTDINATDPKKK-ALFPVVLGHECAGIVESVGP
1e3lA           -----------LCIEEIEVSPPKACEVRIQVIATCVCHTDINATDPKKK-ALFPVVLGHECAGIVESVGP
1e3eB           -----------LCIEEIEVSPPKACEVRIQVIATCVCPTDINATDPKKK-ALFPVVLGHECAGIVESVGP
1e3eA           -----------LCIEEIEVSPPKACEVRIQVIATCVCPTDINATDPKKK-ALFPVVLGHECAGIVESVGP
2cd9B           MKAIIVKPPNA-GVQVKDVDEKSYGKIKIRTIYNGICGTDREIVNGKLTLGKDFLVLGHEAIGVVE---E
1yb5A           -----------------AVPIPKDHQVLIKVHACGVNPVETYIRSGYSRKPLLPYTPGSDVAGVIEAVGD
2cdbB           MKAIIVKPPNA-GVQVKDVDEKSYGKIKIRTIYNGICGADREIVNG--KLGKDFLVLGHEAIGVVE---E
2cdaB           MKAIIVKPPNA-GVQVKDVDEKSYGKIKIRTIYNGICGTDREIVNG--KLGKDFLVLGHEAIGVVE---E
2cd9A           MKAIIVKPPNA-GVQVKDVDEKSYGKIKIRTIYNGICGTDREIVNGKLTLSKGKLVLGHEAIGVVE---E
2cdbC           MKAIIVKPPNA-GVQVKDVDEKSYGKIKIRTIYNGICGADREIVNGK---LKDFLVLGHEAIGVVE---E
2cdbA           MKAIIVKPPNA-GVQVKDVDEKSYGKIKIRTIYNGICGADREIVNGKLK-GKDFLVLGHEAIGVVE---E
2cdaA           MKAIIVKPPNA-GVQVKDVDEKSYGKIKIRTIYNGICGTDREIVNGKLK-GKDFLVLGHEAIGVVE---E
1yqdA           -------------------------DVRFKVLYCGVCHSDLHSIKNDWGFSMYPLVPGHEIVGEVTEXXX
2hcyA           ---IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLVKLPLXXXXXXXXXXXXXXX
3fbgA           LKAIGFEQPFKLSFKTFNLDIPEPKVHEILVKIQSISVNPVDTKQRLMDVSKAPRVLGFDAIGVVESVGN
2b5wA           -RPVVIEKPR---------PEPESGEALVRTLRVGVCGTDHEVIAGGHPEGEDHLVLGHEAVGVVVDPND
2b5vA           MKAIAVKRGRPVVIE-KPRPEPESGEALVRTLRVGVDGTDHEVIAGGHPEGEDHLVLGHEAVGVVVDPND
2ouiA           ----------------KKIPECGPLDALVRPLALAPCTSDTHTVWAGAIGDRHDMILGHEAVGQIVKVGS
3fbgB           LKAIGFEQPNLFKTFNLDIPEPKVHEILVKIQSISVNPVDTK----QRLMDVSPRVLGFDAIGVVESVGN
2vwgA           -RPVVIEKPR---------PEPESGEALVRTLRVGVDGTDHEVIAGGHPEGEDHLVLGHEAVGVVVDPND
1y9aA           ----------------KKIPECGPLDALVRPLALAPCTSDTHTVWAGAIGDRHDMILGHEAVGQIVKVGS
2c0cB           ------------------VPLPGDGDLLVRNRFVGVNASDINYSAGYDPSVKPPFDIGFEGIGEVVALGL
2c0cA           ------------------VPLPGDGDLLVRNRFVGVNASDINYSAGYDPSVKPPFDIGFEGIGEVVALGL
1tt7A           ------------TISTEDLPKDG---VLIKVAYSGINYKDGLAGKGGNIVREYPLILG------IDAAGT
3gazB           --AVVEEANGPFVLRKLARPQPAPGQVLVQIEASGTNPLDAKIRAGEAPHAQLPAILG-DLAGTVVAVGP
3gazA           --AVVEEANGPFVLRKLARPQPAPGQVLVQIEASGTNPLDAKIRAGEAPHAQLPAILG-DLAGTVVAVGP
3gmsA           -----------------------------------------------------PNIPGYEGVGIVENVGA


                         .         .         *         .         .         .         .:140
query           NVNRDRIGERVSVDPVISCGHCYPCSVGKPNVCTSLVVLGVHRDGGFSEYAVAPARNAHRIPDNIADHHA
1e3jA           NVKHLKKGDRVAVEPGVPCRRCQFCKEGKYNLCPDLTFCATPDDGNLARYYVHAADFCHKLPDNVSLEEG
2dq4A           GVRRPQVGDHVSLESHIVCHACPACRTGNYHVCLNTQILGVDRDGGFAEYVVVPAENAWVNPKDLPFEVA
1pl8A           SVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPDDGNLCRFYKHNAAFCYKLPDNVTFEEG
2dfvA           XXXXXXXXDYVSVETHIVCGKCYACRRGQYHVCQNTKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYA
3gfbA           XXXDLQVGDYISVETHIVCGKCYACKHNRYHVCQNTKIFGVDMDGVFAHYAIVPAKNAWKNPKDMPPEYA
1pl6A           SVKHLKPGDRVAIEPGAPRENDEFCK-GRYNLSPSIFFCATPPDGNLCRFYKHNAAFCYKLPDNVTFEEG
2d8aA           XXXXXXXXDYVSVETHIVCGKCY------------TKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYA
2eerB           EVVGYSKGDLVAVNPWEGEGNCYYCRIGEEHLCDSPRWLGINYDGAYAEYVLVP---HYKYLYKLRRLSA
2eerA           EVVGYSKGDLVAVNPWEGEGNCYYCRIGEEHLCDSPRWLGINYDGAYAEYVLVP---HYKYLYKLRRLSA
3ip1C           EAINRRTNKRFEIEPVCACGHCRPCAEGFPNHCENLNELGFNVDGAFAEYVKVDAKYAWSLRELEGVYEG
3ip1A           EAINRRTNKRFEIEPVCACGHCRPCAEGFPNHCENLNELGFNVDGAFAEYVKVDAKYAWSLRELEGVYEG
3i4cH           EVVGYSKGDLVAVNPLQGEGNCYYCRIGEEHLCDSPRWLGINFDGAYAEYVIVP----------------
1rjwA           XXTHLKVGDRVGIPWLYSCGHCDYCLSGQETLCEHQKNAGYSVDGGYAEYCRAAADYVVKIPDNLSFEEA
3i4cA           EVVGYSKGDLVAVNPLQGEGNCYYCRIGEEHLCDSPRWLGINFDGAYAEYVIVP----------------
1h2bB           GVEGLEKGDPVILHPAVTDGTCLACRAGEDMHCENLEFPGLNIDGGFAEFMRTSHRSVIKLPKDISREKL
1h2bA           GVEGLEKGDPVILHPAVTDGTCLACRAGEDMHCENLEFPGLNIDGGFAEFMRTSHRSVIKLPKDISREKL
1vj0D           K--RDLNGELLKPGDLITCGECYWCKVSKPYLCPNRKVYGINR--GCSEYPLRGCYSSHIVLDKVSEKDD
1vj0B           K--RDLNGELLKPGDLITCGECYWCKVSKPYLCPNRKVYGINR--GCSEYPLRGCYSSHIVLDKVSEKDD
1vj0A           K--RDLNGELLKPGDLITCGECYWCKVSKPYLCPNRKVYGINR--GCSEYPLRGCYSSHIVLDKVSEKDD
1lluA           XXTRVKEGDRVGIPWLTACGCCEHCLTGWETLCESQQNTGYSVNGGYAEYVLADPNYVGILPKNVAEIAP
1r37A           EVVGYSKGDLVAVNPWQGEGNCYYCRIGEEHLCDSPRWLGINFDGAYAEYVIVP----------------
1ntoA           EVVGYSKGDLVAVNPWQGEGNCYYCRIGEEHLCDSPRWLGINFDGAYAEYVIVP----------------
3i4cD           VVGYSK-GDLVAVNPLQGEGNCYYCRIGEEHLCDSPRWLGINFDGAYAEYVIVP----------------
3i4cE           EVVGYSKGDLVAVNPLQGEGNCYYCRIGEEHLCDSPRWLGINFDGAYAEYVIVP----------------
3i4cB           EVVGYSKGDLVAVNPLQGEGNCYYCRIGEEHLCDSPRWLGINFDGAYAEYVIVP----------------
1jvbA           EVVGYSKGDLVAVNPWQGEGNCYYCRIGEEHLCDSPRWLGINFDGAYAEYVIVP----------------
1hdzA           GVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLRGTLQDGTFSQYTVVDENAVAKI-DAASPLEK
1htbA           GVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLRGTLQDGTFSQYTVVDENAVAKI-DAASPLEK
3i4cC           EVVGYSKGDLVAVNPLQGEGNCYYCRIGEEHLCDSPRWLGINFDGAYAEYVIVP----------------
1ee2A           GVTTVRPGDKVIPLFIPQCGKCSVCKHPEGNLCLKNLSMGTMQDGTFSQYTVVDEISVAKI-DAASPLEK
1u3uA           GVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLRGTLQDGTFSQYTVVDENAVAKI-DAASPLEK
1hdyA           GVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLRGTLQDGTFSQYTVVDENAVAKI-DAASPLEK
2eihA           XXEGFAPGDEVVINPGLSCGRCERCLAGEDNLCPRYQILGEHRHGTYAEYVVLPEANLAPKPKNLSFEEA
1hsoA           GVTTVKPGDKVIPLAIPQCGKCRICKNPESNYCLKNDVQGTLQDGTFSQYTVVDENAVAKI-DAASPLEK
2h6eA           -LAKVKKGDNVVVYATWGDLTCRYCREGKFNICKNQIIPGQTTNGGFSEYLVKSSRWLVKLNSLSPVEAA
1qlhA           GVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKSMPRGTMQDGTFSQYTVVDEISVAKI-DAASPLEK
1n8kA           GVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKSMPRGTMQDGTFSQYTVVDEISVAKI-DAASPLEK
1p0fA           GVTCVKPGDKVIPLFVPQCGSCRACKSSNSNFC-------------------------------------
1mgoA           GVTTVRPGDKVIPLATPQCGKCRVCKHPEGNFCLKSMPRGTMQDGTFSQYTVVDEISVAKI-DAASPLEK
1d1tA           GVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCSDITGRGVLADGTFTEYTVVDESSVAKIDDAAPPEKV
1d1sA           GVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCSDITGRGVLADGTFTEYTVVDESSVAKIDDAAPPEKV
1ju9A           GVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKSMPRGTMQDGTFSQYTVVDEISVAKI-DAASPLEK
1hetA           GVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKSMPRGTMQDGTFSQYTVVDEISVAKI-DAASPLEK
1axeA           GVTTVRPGDKVIPLWTPQCGKCRVCKHPEGNFCLKSMPRGTMQDGTFSQYTVVDEISVAKI-DAASPLEK
1axgA           GVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKSMPRGTMQDGTFSQYTVVDEISVAKI-DAASPLEK
1a71A           GVTTVRPGDKVIPLWTPQCGKCRVCKHPEGNFCLKSMPRGTMQDGTFSQYTVVDEISVAKI-DAASPLEK
2dphA           DVELMDIGDLVSVPFNVACGRCRNCKEARSDVCENNLVLGAFGSGGQAEYVLVPYADYMLLKFGDKEQAM
1uufA           QVEKYAPGDLVGVGCIVSCKHCEECEDGLENYCDHMTGTPGHTLGGYSQQIVVHERYVLRI---------
2fzeA           GVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTGLMPDGTFSEYTVVADISVAKI-DPLAPLDK
1f8fA           NVTELQVGDHV----VLSCGKCTQCNTGNPAYCSEF--FGRNFSGADSEGNHALCVNDHFFAQSSFATYA
1qv6A           GVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKSMPRGTMQDGTFSQYTVVDEISVAKI-DAASPLEK
1piwA           KSNSGKVGQRVGVGQVFSCLECDRCKNDNEPYCTKFVTTGYVSQGGYANYVRVHEHFVVPIPENIPSHLA
2fzwA           GVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTGLMPDGTFSEYTVVADISVAKI-DPLAPLDK
1u3wA           GVTTVKPGDKVIPLFTPQCGKCRICKNPESNYC-------------------------------------
1cdoA           GVTEFQPGEKVIPLFISQCGECRFCQSPKTNQC-------------------------------------
3cosD           GVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKIPVYHFFGTSTFSQYTVVSDINLAKIDDD-ANLER
3cosA           GVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKIPVYHFFGTSTFSQYTVVSDINLAKIDDD-ANLER
1kolA           DVENLQIGDLVSVPFNVACGRCRSCKEMHTGVCLTVVDMG-DWTGGQAEYVLVPYANLLKLPDR--DKAM
1e3lB           GVTNFKPGDKVIPFFAPQCKRCKLCLSPLTNLCGKLHFMGV---SSFSQYTVVSEANLARVDDE-ANLER
1e3lA           GVTNFKPGDKVIPFFAPQCKRCKLCLSPLTNLCGKLHFMGV---SSFSQYTVVSEANLARVDDE-ANLER
1e3eB           GVTNFKPGDKVIPFFAPQCKRCKLCLSPLTNLCGKLHFMGV---SSFSQYTVVSEANLARVDDE-ANLER
1e3eA           GVTNFKPGDKVIPFFAPQCKRCKLCLSPLTNLCGKLHFMGV---SSFSQYTVVSEANLARVDDE-ANLER
2cd9B           SYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETFGEAGIHKDGFMREWWYDDPKYLVKIPKSIED-IG
1yb5A           NASAFKKGDRVFTSSTIS--------------------------GGYAEYALAADHTVYKLPEKLKQGAA
2cdbB           SYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETFGEAGIHKDGFMREWWYDDPKYLVKIPKSIED-IG
2cdaB           SYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETFGEAGIHKDGFMREWWYDDPKYLVKIPKSIED-IG
2cd9A           SYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETFGEAGIHKDGFMREWWYDDPKYLVKIPKSIED-IG
2cdbC           SYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETFGEAGIHKDGFMREWWYDDPKYLVKIPKSIED-IG
2cdbA           SYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETFGEAGIHKDGFMREWWYDDPKYLVKIPKSIED-IG
2cdaA           SYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETFGEAGIHKDGFMREWWYDDPKYLVKIPKSIED-IG
1yqdA           XXXXXXXXXXXXXXCLVACHSCESCANDLENYCPKMILASIYHDGGYSNHMVANERYIIRFPDNM-----
2hcyA           XXKGWKIGDYAGIKWLNSCMACEYCELGNESNCPHADLSGYTHDGSFQQYATADAVQAAHIP--------
3fbgA           EVTMFNQGDIVYYS-------------GSPD-----------QNGSNAEYQLINERLVAKAPKNISAEQA
2b5wA           TEEGDIVVPTVRRPPASGTNEYFQPDMAPDGMYFERGIVGAH--GYMSEFFTSPEKYLVRIPRSQAE-LG
2b5vA           TEEGDIVVPTVRRPPASGTNEYFQPDMAPDGMYFERGIVGAH--GYMSEFFTSPEKYLVRIPRSQAE-LG
2ouiA           LVKRLKVGDKVIVPAITPDWGEEESQRGYPMHSGGMLKFSNFKDGVFSEHVNEADANLALLPRDIKPEDA
3fbgB           EVTMFNQGDIVYYS-------------GSPD-----------QNGSNAEYQLINERLVAKAPKNISAEQA
2vwgA           TEEGDIVVPTVRRPPASGTNEYFQPDMAPDGMYFERGIVGAH--GYMSEFFTSPEKYLVRIPRSQAE-LG
1y9aA           LVKRLKVGDKVIVPAITPDWGEEESQRGYPMHSGGMLKFSNFKDGVFSEHVNEADANLALLPRDIKPEDA
2c0cB           SASRYTVGQAVAY----------------------------MAPGSFAEYTVVPASIATPVPSVKPEYLT
2c0cA           SASRYTVGQAVAY----------------------------MAPGSFAEYTVVPASIATPVPSVKPEYLT
1tt7A           VVS--------SNDPRFAEGD---------EVIATSYELGVSRDGGLSEYASVPGDWLVPLPQNLSLKEA
3gazB           EVDSFRV---------------------------------------------------------------
3gazA           EVDSFRV---------------------------------------------------------------
3gmsA           FVSRELIGKR---------------------------VLPLRGEGTWQEYVKTSADFVVPIPDSIDDFTA


                         +         .         .         .         .         *         .:210
query           VMVEPFTIAANVTGQVNPTEQDVALIYGAGPMGLTTVQALKGVYQVKTVIVVDRIEERLAMAKQSGADWT
1e3jA           ALLEPLSVGVHACRRAGVQLGTTVLVIGAGPIGLVSVLAAKGAF----VVCTARSPRRLEVAKNCGADVT
2dq4A           AILEPFGNAVHTVYAGSGVSGKSVLITGAGPIGLMAAMVVR-ASGAGPILVSDPNPYRLAFARPY-ADRL
1pl8A           ALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQ-VVVTDLSATRLSKAKEIGADLV
2dfvA           TLQEPLGNAVD-TVLAGPISGKSVLITGAGPLGLLGIAVAKGAY---PVIVSEPSDFRRELAKKVGADYV
3gfbA           ALQEPLGNAVD-TVLAGPIAGRSTLITGAGPLGLLGIAVAKGAY---PVIVSEPSEFRRKLAKKVGADYV
1pl6A           ALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGVTLLVAKAGAAQ---VVVTDLSATRLSKAKEIGADLV
2d8aA           TLQEPLGNAVD-TVLAGPISGKSVLITGAGPLGLLGIAVAKGAY---PVIVSEPSDFRRELAKKVGADYV
2eerB           VEAAPLTCSGVTTASLDPSKTLVVIGAGGG-LGTMAIQIAKAV-SGATIIGVDVREEALEAAKRAGADYV
2eerA           VEAAPLTCSGVTTASLDPSKTLVVIGAGGG-LGTMAIQIAKAV-SGATIIGVDVREEALEAAKRAGADYV
3ip1C           SLVEPTSVAYNAVGGIRP--GDNVVILGGGPIGLAAVAILKHAGASK-VILSEPSEVRRNLAKELGADHV
3ip1A           SLVEPTSVAYNAVGGIRP--GDNVVILGGGPIGLAAVAILKHAGASK-VILSEPSEVRRNLAKELGADHV
3i4cH           ----------------------------------------------------------------------
1rjwA           APIFCAGVALKVTG-AKPGEW--VAIYGIGGLGHVAVQYAKAM--GLNVVAVDIGDEKLELAKELGADLV
3i4cA           ----------------------------------------------------------------------
1h2bB           VEMAPLADAGTAYRAVKKAARTLVAIVGVGGLGHIAVQLLK-VMTPATVIALDVKEEKLKLAERLGADHV
1h2bA           VEMAPLADAGTAYRAVKKAARTLVAIVGVGGLGHIAVQLLK-VMTPATVIALDVKEEKLKLAERLGADHV
1vj0D           LDVLAMAMCSGATAYHAFDEYPTVVIQGAGPLGLFGVVIARSL-GAENVIVIAGSPNRLKLAEEIGADLT
1vj0B           LDVLAMAMCSGATAYHAFDEYPTVVIQGAGPLGLFGVVIARSL-GAENVIVIAGSPNRLKLAEEIGADLT
1vj0A           LDVLAMAMCSGATAYHAFDEYPTVVIQGAGPLGLFGVVIARSL-GAENVIVIAGSPNRLKLAEEIGADLT
1lluA           ILCAGVTVYKGLK-QTNARPGQWVAISGIGGLGHVAVQYARAMGLHVAAIDID--DAKLELARKLGASLT
1r37A           ----------------------------------------------------------------------
1ntoA           ----------------------------------------------------------------------
3i4cD           ----------------------------------------------------------------------
3i4cE           ----------------------------------------------------------------------
3i4cB           ----------------------------------------------------------------------
1jvbA           ----------------------------------------------------------------------
1hdzA           VCLIGCGFSTGYGSAVNVTPGSTCAVFGLGGVGLSAVMGCKAAGAAR-IIAVDINKDKFAKAKELGATEC
1htbA           VCLIGCGFSTGYGSAVNVTPGSTCAVFGLGGVGLSAVMGCKAAGAAR-IIAVDINKDKFAKAKELGATEC
3i4cC           ----------------------------------------------------------------------
1ee2A           VCLVGCGFSTGYGSAVKVTQGSTCAVFGLGGVGLSVIMGCKAAGAAR-IIGVDINKDKFAKAKEVGATEC
1u3uA           VCLIGCGFSTGYGSAVNVTPGSTCAVFGLGGVGLSAVMGCKAAGAAR-IIAVDINKDKFAKAKELGATEC
1hdyA           VCLIGCGFSTGYGSAVNVTPGSTCAVFGLGGVGLSAVMGCKAAGAAR-IIAVDINKDKFAKAKELGATEC
2eihA           AAI-PLTFLTMVVDKLGVRPGDDVLVMXXXXXXXXXXIQIAKLFGAR-VIATAGSEDKLRRAKALGADET
1hsoA           VCLIGCGFSTGYGSAVNVTPGSTCAVFGLGGVGLSAIMGCKAAGAAR-IIAVDINKDKFAKAKELGATEC
2h6eA           PLADAGTTSMGAIRQALPFAEPVVIVNGIGGLAVYTIQILKALMKNITIVGISRSKKHRDFALELGADY-
1qlhA           VCLIGCGFSTGYGSAVKVTQGSTCAVFGLGGVGLSVIMGCKAAGAAR-IIGVDINKDKFAKAKEVGATEC
1n8kA           VCLIGCGFSTGYGSAVKVTQGSTCAVFGLGGVGLSVIMGCKAAGAAR-IIGVDINKDKFAKAKEVGATEC
1p0fA           ----------------------------------------------------------------------
1mgoA           VCLIGCGFSTGYGSAVKVTQGSTCAVFGLGGVGLSVIMGCKAAGAAR-IIGVDINKDKFAKAKEVGATEC
1d1tA           CLIGGFSTAAVKTGKVKP--GSTCXXXXXXXXXXXXIMGCKSA-GASRIIGIDLNKDKFEKAMAVGATEC
1d1sA           CLIGGFSTAAVKTGKVKP--GSTCXXXXXXXXXXXXIMGCKSA-GASRIIGIDLNKDKFEKAMAVGATEC
1ju9A           VCLIGCGFSTGYGSAVKVTQGSTCAVFGLGGVGLSVIMGCKAAGAAR-IIGVDINKDKFAKAKEVGATEC
1hetA           VCLIGCGFSTGYGSAVKVTQGSTCAVFGLGGVGLSVIMGCKAAGAAR-IIGVDINKDKFAKAKEVGATEC
1axeA           VCLIGCGFSTGYGSAVKVTQGSTCAVFGLGGVGLSVIMGCKAAGAAR-IIGVDINKDKFAKAKEVGATEC
1axgA           VCLIGCGFSTGYGSAVKVTQGSTCAVFGLGGAGLSVIMGCKAAGAAR-IIGVDINKDKFAKAKEVGATEC
1a71A           VCLIGCGFSTGYGSAVKVTQGSTCAVFGLGGAGLSVIMGCKAAGAAR-IIGVDINKDKFAKAKEVGATEC
2dphA           EKIKDLTLISDILGCVSAGVKPGSHVYGAGPVG-XXXXXXXXXXXXXXVIVGDQNPERLKLLSDAG----
1uufA           ----------------------------------------------------------------------
2fzeA           VCLLGCGISTGYGAAVNTAKLEPGSXXXXXXXXXXXXXXIMGVAGASRIIGVDINKDKFARAKEFGATEC
1f8fA           LSRENNTV--KVTKDV-PIELLGPLGCGIQTGAGACINALKKVCGASIIIAVDIVESRLELAKQLGATHV
1qv6A           VCLIGCGFSTGYGSAVKVTQGSTCAVFGLGGVGLSVIMGCKAAGAAR-IIGVDINKDRFAKAKEVGATEC
1piwA           ----------------------------------------------------------------------
2fzwA           VCLLGCGISTGYGAAVNTAKLEPGSXXXXXXXXXXXXXXIMGVAGASRIIGVDINKDKFARAKEFGATEC
1u3wA           ----------------------------------------------------------------------
1cdoA           ----------------------------------------------------------------------
3cosD           VCLLGCGFSTGYGAAINVTPGSTCAVFGLGGVGLSAVMGCKAA-GASRIIGIDINSEKFVKAKALGATDC
3cosA           VCLLGCGFSTGYGAAINVTPGSTCAVFGLGGVGLSAVMGCKAA-GASRIIGIDINSEKFVKAKALGATDC
1kolA           EKIRDLTCLSDIL----PTGYHGAVTAGVGP---------------------------------------
1e3lB           VCLIGCGFSSGYGAAINTTPGSTCAVFGLGCVGLSAIIGCK-IAGASRIIAIDINGEKFPKAKALGATDC
1e3lA           VCLIGCGFSSGYGAAINTTPGSTCAVFGLGCVGLSAIIGCK-IAGASRIIAIDINGEKFPKAKALGATDC
1e3eB           VCLIGCGFSSGYGAAINTTPGSTCAVFGLGCVGLSAIIGCK-IAGASRIIAIDINGEKFPKAKALGATDC
1e3eA           VCLIGCGFSSGYGAAINTTPGSTCAVFGLGCVGLSAIIGCK-IAGASRIIAIDINGEKFPKAKALGATDC
2cd9B           ILAQPLADIEKSIEEILEVQKRVVLVVGTGPIGV------------------------------------
1yb5A           IGIPYFTAYRALIHSACVKAGESVLVHGAGGVGLAACQIAR-AYGLK-ILGTAGTEEGQKIVLQNGAHEV
2cdbB           ILAQPLADIEKSIEEILEVQKRVVLVVGTGPIGV------------------------------------
2cdaB           ILAQPLADIEKSIEEILEVQKRVVLVVGTGPIGV------------------------------------
2cd9A           ILAQPLADIEKSIEEILEVQKRVVLVVGTGPIGV------------------------------------
2cdbC           ILAQPLADIEKSIEEILEVQKRVVLVVGTGPIGV------------------------------------
2cdbA           ILAQPLADIEKSIEEILEVQKRVVLVVGTGPIGV------------------------------------
2cdaA           ILAQPLADIEKSIEEILEVQKRVVLVVGTGPIGV------------------------------------
1yqdA           ----------------------------------------------------------------------
2hcyA           ----------------------------------------------------------------------
3fbgA           VSLPLTGITAGISRNRNENEKTLLIINGAGGVGSIATQIAK-AYGLRVITTASR-NETIEWTKKMGADIV
2b5wA           FLIEPISITAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKGYENLYCLGRRDRPDPTIDIIEE--LDAT
2b5vA           FLIEPISITAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKGYENLYCLGRRDRPDPTIDIIEE--LDAT
2ouiA           VMLDMVTTGFHGAELANIKLGDTVCVIGIGPVGLMSVAGANHLGAGRIFAVGSR-KHCCDIALEYGATDI
3fbgB           VSLPLTGITAGISRNRNENEKTLLIINGAGGVGSIATQIAK-AYGLRVITTASR-NETIEWTKKMGADIV
2vwgA           FLIEPISITAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKGYENLYCLGRRDRPDPTIDIIEE--LDAT
1y9aA           VMLDMVTTGFHGAELANIKLGDTVCVIGIGPVGLMSVAGANHLGAGRIFAVGSR-KHCCDIALEYGATDI
2c0cB           LLVSGTTAYISLKELGGLSEKKVLVTAAAGGTGQFAMQLSK---KAKCVIGTCSSDEKSAFLKSLGCDRP
2c0cA           LLVSGTTAYISLKELGGLSEKKVLVTAAAGGTGQFAMQLSK---KAKCVIGTCSSDEKSAFLKSLGCDRP
1tt7A           VYTAGFTAALSV----------------------------------------------------------
3gazB           ----------------------------------------------------------------------
3gazA           ----------------------------------------------------------------------
3gmsA           MYINPLTAWVTCTETLNLQRNDVLLVNACG----------------------------------------


                         .         .         .         +         .         .         .:280
query           LNNGQHSLAEFLQQKALKPTLIVDAACHPAILQEAITLASPAARIVLMGFSSDPCEIVQQGITGKELAIY
1e3jA           LAKXXXXXXXXXXXXAILPNVTIDCSGNEKCXXXXXXXXXXXXXLMLVGMGSQMVTVPLVNACAREIDIK
2dq4A           VNPLEEDLLEVVRRTGSGVEVLLEFSGNEAAIHQGLMALIPGGEARILGIPSDPIELVMRGITAFGIALW
1pl8A           LQISKESPQEIARQLGCKPEVTIECTGAEASIQAGIYATRSXXXXXXXXXXSEMTTVPLLHAAIREVDIK
2dfvA           INPFEEDVVKEVDTDGNGVDVFLEFSGAPKALEQGLQAVTPAGRVSLLGLYPGKVTIFNNLIIFKALTIY
3gfbA           VNPFEEDPVKFVMDDGAGVEVFLEFSGAPKALEQGLKAVTPGGRVSLLGFPREVTIDFNNLIIFKALEVH
1pl6A           LQISKESPQEIARQLGCKPEVTIECTGAEASIQAGIATRXXXXXXXXXXXXXXXXPLLHAAI--REVDIK
2d8aA           INPFEEDVVKEVDTDGNGVDVFLEFSGAPKALEQGLQAVTPAGRVSLLGLYPGKVTIFNNLIIFKALTIY
2eerB           INSSQDPVSEIRRTQGKGADAVIDLNNSEKTLSIYPYVLAKQGKYVMVGLFGADLKYHAPLITLNEVQFI
2eerA           INSSQDPVSEIRRTQGKGADAVIDLNNSEKTLSIYPYVLAKQGKYVMVGLFGADLKYHAPLITLNEVQFI
3ip1C           IDPTKENFVE------------------------------------------------------------
3ip1A           IDPTKENFVE------------------------------------------------------------
3i4cH           ----------------------------------------------------------------------
1rjwA           VNPLKEDAAKFMKEK-------------------------------------------------------
3i4cA           ----------------------------------------------------------------------
1h2bB           VDARRDPVKQVMETRGRGVNVAMDFVGSQATVDYTPYLLGRMGRLIIVGYGGE-----------------
1h2bA           VDARRDPVKQVMETRGRGVNVAMDFVGSQATVDYTPYLLGRMGRLIIVGYGGE-----------------
1vj0D           LNRRETSVEE------------------------------------------------------------
1vj0B           LNRRETSVEE------------------------------------------------------------
1vj0A           LNRRETSVEE------------------------------------------------------------
1lluA           VNARQEDPVEAIQRDIGGAHGVLVTAVSNSAFGQAIGMARRGGTIALVGLGDFPTPIFDVVLKGLHIAIV
1r37A           ----------------------------------------------------------------------
1ntoA           ----------------------------------------------------------------------
3i4cD           ----------------------------------------------------------------------
3i4cE           ----------------------------------------------------------------------
3i4cB           ----------------------------------------------------------------------
1jvbA           ----------------------------------------------------------------------
1hdzA           INPQDYKIQEVLKEMTLDTMMASLLCCHEACGTSVIVGVPPASQ----NLSINPM-LLLTGRTWKG-AVY
1htbA           INPQDYKIQEVLKEMTLDTMMASLLCCHEACGTSVIVGVPPASQ----NLSINPM-LLLTGRTWKG-AVY
3i4cC           ----------------------------------------------------------------------
1ee2A           VNPQDYKIQEVLTEMSLDTMVAALSCCQEAYGVSVIVGVPPDSQ----NLSMNPM-LLLSGRTWKG-AIF
1u3uA           INPQDYKIQEVLKEMTLDTMMASLLCCHEACGTSVIVGVPPASQ----NLSINPM-LLLTGRTWKG-AVY
1hdyA           INPQDYKIQEVLKEMTLDTMMASLLCCHEACGTSVIVGVPPASQ----NLSINPM-LLLTGRTWKG-AVY
2eihA           VN--------------------------------------------------------------------
1hsoA           INPQDYKIQEVLKEMTLDTMMASLLCCHEACGTSVIVGVPPDSQ----NLSMNPM-LLLTGRTWKGAILG
2h6eA           ----------------------------------------------------------------------
1qlhA           VNPQDYKIQEVLTEMSLDTMVTALSCCQEAYGVSVIVAVTPDSQ----NLSMNPM-LLLSGRTWKG-AIF
1n8kA           VNPQDYKIQEVLTEMSLDTMVTALSCCQEAYGVSVITGVPPDSQ----NLSMNPM-LLLSGRTWKG-AIF
1p0fA           ----------------------------------------------------------------------
1mgoA           VNPQDYKIQEVLTEMSLDTMVTALSCCQEAYGVSVIVGVPPDSQ----NLSMNPM-LLLSGRTWKG-AIF
1d1tA           ISDSTKPISEVLSEMTLETMIDALASCHMNYGTSVVVGVPPSAKML----TYDPM-LLFTGRTWKG-CVF
1d1sA           ISDSTKPISEVLSEMTLETMIDALASCHMNYGTSVVVGVPPSAKML----TYDPM-LLFTGRTWKG-CVF
1ju9A           VNPQDYKIQEVLTEMSLDTMVTALSCCQEAYGVSVISGVPPDSQ----NLSMNPM-LLLSGRTWKG-AIF
1hetA           VNPQDYKIQEVLTEMSLDTMVTALSCCQEAYGVSVIVGVPPDSQ----NLSMNPM-LLLSGRTWKG-AIF
1axeA           VNPQDYKIQEVLTEMSLDTMVTALSCCQEAYGVSVIVGVPPDSQ----NLSMNPM-LLLSGRTWKG-AIF
1axgA           VNPQDYKIQEVLTEMSLDTMVTALSCCQEAYGVSVIVGVPPDSQ----NLSMNPM-LLLSGRTWKG-AIF
1a71A           VNPQDYKIQEVLTEMSLDTMVTALSCCQEAYGVSVIVGVPPDSQ----NLSMNPM-LLLSGRTWKG-AIF
2dphA           ----------------------------------------------------------------------
1uufA           ----------------------------------------------------------------------
2fzeA           IN--------------------------------------------------------------------
1f8fA           INSTQDPVAAIKEITDGGVNFALESTGSPEILKQGVDALGILGKIAVVG---------------------
1qv6A           VNPQDYKIQEVLTEMSLDTMVTALSCCQEAYGVSVIVGVPPDSQ----NLSMNPM-LLLSGRTWKG-AIF
1piwA           ----------------------------------------------------------------------
2fzwA           IN--------------------------------------------------------------------
1u3wA           ----------------------------------------------------------------------
1cdoA           ----------------------------------------------------------------------
3cosD           LN--PRDLHKPIQEVIIELTKGVDFALDCAGGSETM---KAALDCTTAGWGS--CTFIGVAAGSKGLTVF
3cosA           LN--PRDLHKPIQEVIIELTKGVDFALDCAGGSETM---KAALDCTTAGWGS--CTFIGVAAGSKGLTVF
1kolA           ----------------------------------------------------------------------
1e3lB           LN--PRELDKPVQDVITELTYSLDCAGTAQTLKAAVDCTVLGGSCTVVGAKVDEMTITVDVILGRSITFF
1e3lA           LN--PRELDKPVQDVITELTYSLDCAGTAQTLKAAVDCTVLGGSCTVVGAKVDEMTITVDVILGRSITFF
1e3eB           LN--PRELDKPVQDVITELTYSLDCAGTAQTLKAAVDCTVLGGSCTVVGAKVDEMTITVDVILGRSITFF
1e3eA           LN--PRELDKPVQDVITELTYSLDCAGTAQTLKAAVDCTVLGGSCTVVGAKVDEMTITVDVILGRSITFF
2cd9B           ----------------------------------------------------------------------
1yb5A           FNHREDKIKKYVGEKGI--DIIIEMLAN-VNLSKDLSLLSHGGRVIVVG-SRGTIEINPRDTMAKESSI-
2cdbB           ----------------------------------------------------------------------
2cdaB           ----------------------------------------------------------------------
2cd9A           ----------------------------------------------------------------------
2cdbC           ----------------------------------------------------------------------
2cdbA           ----------------------------------------------------------------------
2cdaA           ----------------------------------------------------------------------
1yqdA           ----------------------------------------------------------------------
2hcyA           ----------------------------------------------------------------------
3fbgA           LNHKESLLNQFKTQ--------------------------------------------------------
2b5wA           YVDSRQTPVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFHREMVLH
2b5vA           YVDSRQTPVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFHREMVLH
2ouiA           INYKNGDIVEQILKKGVDKVVIAGGDVH--TFAQAVKMIKPGSDIGNVNYLGEPIPRSEWGVGMGHKHIH
3fbgB           LNHKESLLNQFKTQ--------------------------------------------------------
2vwgA           YVDSRQTPVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFHREMVLH
1y9aA           INYKNGDIVE----QILKATVVIAGGVH--TFAQAVKMIKPGSDIGNVNYEGDNIDIPRSGMGHKHIHGG
2c0cB           INYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFIS------------------
2c0cA           INYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFIS------------------
1tt7A           ----------------------------------------------------------------------
3gazB           ----------------------------------------------------------------------
3gazA           ----------------------------------------------------------------------
3gmsA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SSRLNANKFPVVIDWLNKGLIDPDKLITHTFDYQHVTDAIELFEKDQRQCCKVLLTFxx
1e3jA           SVFRYCNDYPIALEMVASGRCNVKQLVTHSFKLEQTVDAFEAARKKADNTIKVMIS---
2dq4A           QTWMQGTAL------VYSGRVDLSPLLTHRLPLSRYREAFGLLASG--QAVKVIL----
1pl8A           GVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKK--------------
2dfvA           TGRHLWETWYTVSRLLQSGKLNLDPIITHKYGFDKYEEAFEL-----------------
3gfbA           TGRHLWETWYTVSSLIQSGKLNLDPIITHKYGFDKFEEAFEL-----------------
1pl6A           GVFRYCNTWPVAISLASKS-VNVKPLVTHRFPLEKALEAFETFKK--------------
2d8aA           TGRHLWETWYTVSRLLQSGKLNLDPIITHKYGFDKYEEAFEL-----------------
2eerB           GSLVNQSDFLGIMSLAEAGKVKP--MVTKTMKLEEANEAIDNLE---------------
2eerA           GSLVNQSDFLGIMSLAEAGKVKP--MVTKTMKLEEANEAIDNLE---------------
3ip1C           -----------------------------------------------------------
3ip1A           -----------------------------------------------------------
3i4cH           -----------------------------------------------------------
1rjwA           -----------------------------------------------------------
3i4cA           -----------------------------------------------------------
1h2bB           -----------------------------------------------------------
1h2bA           -----------------------------------------------------------
1vj0D           -----------------------------------------------------------
1vj0B           -----------------------------------------------------------
1vj0A           -----------------------------------------------------------
1lluA           GTRADLQE---ALDFAGEGLV--------------------------------------
1r37A           -----------------------------------------------------------
1ntoA           -----------------------------------------------------------
3i4cD           -----------------------------------------------------------
3i4cE           -----------------------------------------------------------
3i4cB           -----------------------------------------------------------
1jvbA           -----------------------------------------------------------
1hdzA           GGFKSKEGIPLVADFMAK-KFSLDALITHVLPFEKINEGFDLLHSG--KSIRTVLTF--
1htbA           GGFKSKEGIPLVADFMAK-KFSLDALITHVLPFEKINEGFDLLHSGKSIC--TVLTF--
3i4cC           -----------------------------------------------------------
1ee2A           GGFKSKDSVPLVADFMKKFALDP--LITHVLPFEKINEGFDLLRSG--KSIRTILTF--
1u3uA           GGFKSKEGIPLVADFMAK-KFSLDALITHVLPFEKINEGFDLLHSG--KSIRTVLTF--
1hdyA           GGFKSKEGIPLVADFMAK-KFSLDALITHVLPFEKINEGFDLLHSG--KSIRTVLTF--
2eihA           -----------------------------------------------------------
1hsoA           GFKSKECVPKLVADFMAK-KFSLDALITHVLPFEKINEGFDL-----------------
2h6eA           -----------------------------------------------------------
1qlhA           GGFKSKDSVPLVADFMKKFALDP--LITHVLPFEKINEGFDLLRSG--ESIRTILTF--
1n8kA           GGFKSKDSVPLVADFMKKFALDP--LITHVLPFEKINEGFDLLRSG--ESIRTILTF--
1p0fA           -----------------------------------------------------------
1mgoA           GGFKSKDSVPLVADFMKKFALDP--LITHVLPFEKINEGFDLLRSG--ESIRTILTF--
1d1tA           GGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELL--NSGQSIRTVLTF--
1d1sA           GGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELL--NSGQSIRTVLTF--
1ju9A           GGFKSKDSVPLVADFMKKFALDP--LITHVLPFEKINEGFDLLRSG--ESIRTILTF--
1hetA           GGFKSKDSVPLVADFMKKFALDP--LITHVLPFEKINEGFDLLRSG--ESIRTILTF--
1axeA           GGFKSKDSVPLVADFMKKFALDP--LITHVLPFEKINEGFDLLRSG--ESIRTILTF--
1axgA           GGFKSKDSVPLVADFMKKFALDP--LITHVLPFEKINEGFDLLRSG--ESIRTILTF--
1a71A           GGFKSKDSVPLVADFMKKFALDP--LITHVLPFEKINEGFDLLRSG--ESIRTILTF--
2dphA           -----------------------------------------------------------
1uufA           -----------------------------------------------------------
2fzeA           -----------------------------------------------------------
1f8fA           -----------------------------------------------------------
1qv6A           GGFKSKDSVPLVADFMKKFALDP--LITHVLPFEKINEGFDLLRSG--ESIRTILTF--
1piwA           -----------------------------------------------------------
2fzwA           -----------------------------------------------------------
1u3wA           -----------------------------------------------------------
1cdoA           -----------------------------------------------------------
3cosD           PEELSVDSIPLVTDYKNK-KFNLDALVTHTLPFDKISEAFDLM--NQGKSIRTILIF--
3cosA           PEELSVDSIPLVTDYKNK-KFNLDALVTHTLPFDKISEAFDLM--NQGKSIRTILIF--
1kolA           -----------------------------------------------------------
1e3lB           GGWKSVDSVPLVSDYKNK-KFDLDLLVTHALPFESINDAIDLMK--EGKSIRTILTF--
1e3lA           GGWKSVDSVPLVSDYKNK-KFDLDLLVTHALPFESINDAIDLMK--EGKSIRTILTF--
1e3eB           GGWKSVDSVPLVSDYKNK-KFDLDLLVTHALPFESINDAIDLMK--EGKSIRTILTF--
1e3eA           GGWKSVDSVPLVSDYKNK-KFDLDLLVTHALPFESINDAIDLMK--EGKSIRTILTF--
2cd9B           -----------------------------------------------------------
1yb5A           -----------------------------------------------------------
2cdbB           -----------------------------------------------------------
2cdaB           -----------------------------------------------------------
2cd9A           -----------------------------------------------------------
2cdbC           -----------------------------------------------------------
2cdbA           -----------------------------------------------------------
2cdaA           -----------------------------------------------------------
1yqdA           -----------------------------------------------------------
2hcyA           -----------------------------------------------------------
3fbgA           -----------------------------------------------------------
2b5wA           NKAL-------------------------------------------------------
2b5vA           NKAL-------------------------------------------------------
2ouiA           GGLTPGGRVRMLASLISTGKLDTSKLITHRFELEKVEDALMLMK---------------
3fbgB           -----------------------------------------------------------
2vwgA           NKAL-------------------------------------------------------
1y9aA           LTPGGRVRMEKLASLISTGKLDTSKLITHRFELEKVEDALMLMK---------------
2c0cB           -----------------------------------------------------------
2c0cA           -----------------------------------------------------------
1tt7A           -----------------------------------------------------------
3gazB           -----------------------------------------------------------
3gazA           -----------------------------------------------------------
3gmsA           -----------------------------------------------------------