[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:cydD

[Show Plain Result]

#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"

## Summary of PDB Search
:588
    3e-42  28%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    1e-31  27%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    2e-30  24%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-30  24%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    4e-28  32%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    4e-27  30%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    4e-27  30%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    1e-26  28%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    1e-23  30%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    1e-23  30%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-23  30%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-23  30%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-23  30%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    9e-23  28%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    2e-22  30%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-22  30%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-21  34%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    3e-21  28%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    7e-20  33%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    9e-20  30%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    9e-20  30%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-19  29%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    1e-19  33%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    5e-19  30%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-18  30%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-17  30%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    5e-14  30%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-13  30%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    3e-12  25%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  25%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  25%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  25%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  25%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  25%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  25%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  25%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  25%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  25%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  25%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  25%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  25%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  25%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  25%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  25%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  25%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  25%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  25%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  25%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  26%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-12  25%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-12  32%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    7e-12  33%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    7e-12  33%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    2e-11  24%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  24%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  24%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  25%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  24%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-11  25%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    5e-11  25%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-11  25%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-11  24%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-11  24%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-11  24%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-11  32%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    6e-11  28%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    6e-11  26%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-11  25%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-10  35%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    1e-10  28%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-10  29%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-10  29%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-10  25%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    2e-10  25%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-10  25%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-10  25%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-10  28%  2oukB  [x.x.x] PROTEIN ARTP
    4e-10  28%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    7e-10  29%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-10  26%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  24%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  35%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    2e-09  35%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    3e-09  32%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    4e-09  29%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    4e-09  29%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-09  29%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-09  29%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-08  29%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-08  29%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-08  27%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    1e-08  31%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    3e-08  28%  2d2eA  [x.x.x] SUFC PROTEIN
    4e-08  32%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    6e-08  29%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-07  30%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    2e-07  29%  2d2fA  [x.x.x] SUFC PROTEIN
    3e-07  31%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    4e-07  31%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    5e-07  29%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-06  29%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-06  29%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-06  24%  1ji0A  [c.37.1] ABC TRANSPORTER
    1e-05  40%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-05  26%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-05  26%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-05  28%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    5e-05  28%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    7e-05  25%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    9e-05  26%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-04  38%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-04  38%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    0.001  44%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    0.001  44%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    0.001  44%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    0.001  44%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    0.001  44%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    0.001  34%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
:588

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2hydA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxVVWLRERVGFHAGQHIRFEIRRQVLDRLQQAGPAWIQGKPAGSWATLVLEQIDDMHDYYARY
2hydA           --------IEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQVISRVINDVEQTKDFILTG
3b60A           ----------------------------------------------------------------------
3g60A           -------------------AGRQIH-KIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINEGIGDK
3g5uA           -------------------AGRQIH-KIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINEGIGDK
1pf4A           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LPQMALAVCVPLLIVAAIFPSNWAAALILLGTAPLIPLFMAMVGMGAADANRRNFLALARLSGHFLDRLR
2hydA           LMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYVFFGRLRKLTRERSQALAEVQGFLHERVQ
3b60A           -----------------MFYYSWQLSIILVVLAPIVSIAIRVVSKRFRSISKNMQNTMGQVTTSAEQMLK
3g60A           IGMFFQAMAXXXXXXXXXXXXXWKLTLVILAISPVLGLSAGIWAKILSSFTDKELHAYAKAGAVAEEVLA
3g5uA           IGMFFQAMAXXXXXXXXXXXXXWKLTLVILAISPVLGLSAGIWAKILSSFTDKELHAYAKAGAVAEEVLA
1pf4A           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GMETLRIFGRGEAETESIRAASQDFRQRTMEVLRLAFLSSGVLEFFTSLSIALVAVYFGFSYLGELNFGH
2hydA           GISVVKSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGIIVIGVGAYLAISGSITVG-
3b60A           GHKEVLIFGGQEVETKRFDKVSNKMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFSVMDSLTAG-
3g60A           AIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYAL-AFWYGTSLVISKE---
3g5uA           AIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYAL-AFWYGTSLVISKE---
1pf4A           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1z2rA           -------------------------RLQGMKMVSASSISDPIIQLIASLALAFVLYAASFSVMDSLTAG-
2ghiB           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YGTGVTLAAGFLALILAPEFFQPLRDLGTFYHAKAQAVGAADSLKTFLETPLAHPARGEVELAENEPVTI
2hydA           -----TLAAGYLELL-----FGPLRRLVASFTTLTQSFASMDRVFQLIDEDYAQP----IEIKQGR-IDI
3b60A           -----TITVVFSSMIA---LMRPLKSLTNVNAQFQRGMAACQTLFAILDSEQEKDEGKRV--IDRATGDL
3g60A           YSIGQVLTVFFSVLIGAFSVGQASPNIEAFANARGAAY---EVFKIIDNKPSIDSFSKSGHKPDNIQGNL
3g5uA           YSIGQVLTVFFSVLIGAFSVGQASPNIEAFANARGAAY---EVFKIIDNKPSIDSFSKSGHKPDNIQGNL
1pf4A           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1z2rA           -----TITVVFSSMIA---LMRPLKSL-TNVNAQFQRGMAAE----FRNVTFTYPGR-EVPALRN-----
2ghiB           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2yyzA           --------------------------------------------------------------------SI
1g291           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1z47A           -------------------------------------------------------------------MTI
1z47B           --------------------------------------------------------------------TI
1f3oA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1oxvA           -------------------------------------------------------------------VRI
1oxsC           -------------------------------------------------------------------VRI
3gfoA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DAVNLIITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQGSLRINGVELRDLSPES
2hydA           DHVSFQYNDNEAPILKD-INLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVSGQILIDGHNIKDFLTGS
3b60A           EFRNVTFTYPGREVPARNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIEGHILMDGHDLREYTLAS
3g60A           EFKNIHFSYPSRKEILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDLDGMVSIDGQDIRTINVRY
3g5uA           EFKNIHFSYPSRKEILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDLDGMVSIDGQDIRTINVRY
1pf4A           ------------------VSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDGSICLDGHDVRDYKLTN
1mv5D           ------------------ISFEAQPNSIIAFAGPSGGGKSTIFSLLERF--YQGEITIDGQPIDNISLEN
1mv5A           ------------------ISFEAQPNSIIAFAGPSGGGKSTIFSLLERF--YQGEITIDGQPIDNISLEN
2ghiA           ------------------INFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEGDIKIGGKNVNKYNRNS
1mt0A           ---------PDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFIPENGQVLIDGHDLALADPNW
2ff7A           ---------PDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFIPENGQVLIDGHDLALADPNW
2fgkA           ---------PDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFIPENGQVLIDGHDLALADPNW
2ffbA           ---------PDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFIPENGQVLIDGHDLALADPNW
3b5jA           ---------PDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFIPENGQVLIDGHDLALADPNW
2ghiC           ------------------INFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEGDIKIGGKNVNKYNRNS
1xefA           ---------PDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFIPENGQVLIDGHDLALADPNW
2ffaA           ---------PDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFIPENGQVLIDGHDLALADPNW
1z2rA           ------------------INLKIPAGKTVALVGRSGSGKSTIASLITRFYDIEGHILMDGHDLREYTLAS
2ghiB           ------------------INFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEGDIKIGGKNVNKYNRNS
1jj7A           ---------PDVLVLQG-LTFTLRPGEVTALVGPNGSGKSTVAALLQNL--YQGQLLLDGKPLPQYEHRY
2ixfC           ---------PNVQVLQG-LTFTLYPGKVTALVGPNGSGKSTVAALLQNL--YQGKVLLDGEPLVQYDHHY
2ixfA           ---------PNVQVLQG-LTFTLYPGKVTALVGPNGSGKSTVAALLQNL--YQGKVLLDGEPLVQYDHHY
2ghiD           ------------------INFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEGDIKIGGKNVNKYNRNS
2cbzA           -------------TLNG-ITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDVEGHVAIKG----------
2ixgA           ---------PNVQVLQG-LTFTLYPGKVTALVGPNGSGKSTVAALLQNL--YQGKVLLDGEPLVQYDHHY
2ixeA           ---------PNVQVLQG-LTFTLYPGKVTALVGPNGSGKSTVAALLQNL--YQGKVLLDGEPLVQYDHHY
2ixfD           ---------PNVQVLQG-LTFTLYPGKVTALVGPNGSGKSTVAALLQNL--YQGKVLLDGEPLVQYDHHY
2ixeD           ---------PNVQVLQG-LTFTLYPGKVTALVGPNGSGKSTVAALLQNL--YQGKVLLDGEPLVQYDHHY
3d31A           ------------------LSLKVESGEYFVILGPTGAGKTLFLELIAGFVPDSGRILLDGKDVTDLSPE-
1r10A           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1r0zD           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1r0zC           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1r0zB           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1r0zA           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1r0xD           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1r0xC           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1r0xB           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1r0xA           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1r0wC           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1r0wB           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1r0wA           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1q3hD           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1q3hC           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1q3hB           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1q3hA           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1xf9D           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1xf9C           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1xf9B           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
1xf9A           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
2bbsB           ------------------INFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
1xfaA           -----------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELASEGIIKHSG----------
2onkA           ------------------LNVDFEMGDYCVLLGPTGAGKSVFLELIAGIVKPRGEVRLNGADITPLPPE-
2it1B           -------------TALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGYKPTSGKIYFDEKDVTELPPKD
2it1A           -------------TALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGYKPTSGKIYFDEKDVTELPPKD
1xmiE           -----------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
1xmiC           -----------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
1xmiA           -----------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
1xmjA           ------------------INFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
2bboA           -----------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
1g9xA           ---NIVKYFGEFKALDG-VSISVCKGDVTLIIGPNGSGKSTLINVITGFLADEGRVYFENKDITNKEPEL
2pzfB           -----------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
2pzfA           -----------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
2pzgA           -----------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
2pzeB           -----------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
2pzeA           -----------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
2pjzA           -------------------------GEKVIILGPNGSGKTTLLRAISGLLPYSGNIFINGMEVRKIR---
2ihyA           ----------QGKTILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYPATSGTVNLFGKP--GYSAET
2bbtB           ------------------INFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
2bbtA           ----------KGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
1v43A           -------------TAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEETEGRIYFGDRDVTYLPPKD
2ihyB           ----------QGKTILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYPATSGTVNLFGKPGKGYSAET
1l2tB           ------------------VNLNIKEGEFVSIMGPSGSGKSTMLNII-GCLDTEGEVYIDNIKTNDLDDDE
1l2tA           ------------------VNLNIKEGEFVSIMGPSGSGKSTMLNII-GCLDTEGEVYIDNIKTNDLDDDE
1gajA           ---NIVKYFGEFKALDG-VSISVNKGDVTLIIGPNGSGKSTLINVITGFLADEGRVYFENKDITNKEPEL
1g6hA           ---NIVKYFGEFKALDG-VSISVNKGDVTLIIGPNGSGKSTLINVITGFLADEGRVYFENKDITNKEPEL
2bbsA           ----------KGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
1xmiD           -----------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
2oukB           ------------------INVHIREGEVVVVIGPSGSGKSTFLNLLEDFXXXXXXXXXXNLKAKDTNLNK
2oljA           ------------------INVHIREGEVVVVIGPSGSGKSTFLNLLEDFXXXXXXXXXXNLKAKDTNLNK
2awoC           -------------TVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETISGDLFIGEKRMNDTPPAE
1xmiB           -----------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
2pzgB           -----------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSG----------
3fvqB           ------------------ISLSLDPGEILFIIGASGCGKTTLLRCLAGFQPDSGEISLSGKTIKNTNLPV
3fvqA           ------------------ISLSLDPGEILFIIGASGCGKTTLLRCLAGFQPDSGEISLSGKTIKNTNLPV
2qi9C           -------------TRLGPLSGEVRAGEILHLVGPNGAGKSTLL--ARAGTSGKGSIQFAGQPLEAWSATK
1q12A           ------------------INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETISGDLFIGEKRMNDTPPAE
3fh6A           ------------------INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETISGDLFIGEKRMNDTPPAE
2awoA           ------------------INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETISGDLFIGEKRMNDTPPAE
2awnB           ------------------INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETISGDLFIGEKRMNDTPPAE
2r6gB           ------------------INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETISGDLFIGEKRMNDTPPAE
2r6gA           ------------------INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETISGDLFIGEKRMNDTPPAE
3dhwC           ------------------VSLHVPAGQIYGVIGASGAGKSTLIRCVNLLRPTEGSVLVDGQELTTLSESE
1l7vC           -------------TRLGPLSGEVRAGEILHLVGPNGAGKSTLL--ARAGTSGKGSIQFAGQPLEAWSATK
2d2eA           --------SIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYRGEILLDGENILELSPER
2pcjA           ------------------ISLSVKKGEFVSIIGASGSGKSTLLYIL-GLLDTEGKVFLEGKEVKELSLLR
2yyzA           RVVNLKKYFGKVKAVDG-VSFEVKDGEFVALLGPSGCGKTTTLLMLAGYKPTSGEIYFDDVLVNDIPPK-
1g291           -------------TAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEYIGDKLVADPEKGIFVPPK
2d2fA           --------SIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYRGEILLDGENILELSPER
1z47A           EFVGVEKIYPGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLRPTKGDVWIGGKRVTDLPPQ-
1z47B           EFVGVEKIYPGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLRPTKGDVWIGGKRVTDLPPQ-
1f3oA           ------------------VNLNIKEGE-FVSIGPSGSGKSTLNIIGCLDKPTEGEVYIDNIKTNDLDDDE
2nq2D           ------------------LNFDLNKGDILAVLGQNGCGKSTLLDLLLGIRPIQGKIEV--YQSIGFVPQF
2nq2C           ------------------LNFDLNKGDILAVLGQNGCGKSTLLDLLLGIRPIQGKIEV--YQSIGFVPQF
1ji0A           ------------------IDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQGKIIFNGQDITNKPAHV
1vplA           ----------------------------------------------------------------------
2zu0C           --------SVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEGTVEFKGKDLLALSPED
2d3wA           --------SVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEGTVEFKGKDLLALSPED
1oxvA           IVKNVSKVFKKGKVVADNVNINIENGERFGILGPSGAGKTTFMRIIAGLLYFDDRLVASNGKLI-VPPED
1oxsC           IVKNVSKVFKKGKVVADNVNINIENGERFGILGPSGAGKTTFMRIIAGLLYFDDRLVASNGKLI-VPPED
3gfoA           ------------------INMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPIDYSRKG
2d3wB           --------SVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEGTVEFKGKDLLALSPED
2d3wD           --------SVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEGTVEFKGKDLLALSPE-
2d3wC           --------SVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEGTVEFKGKDLLALSPE-
2ix8A           ------------------INFQCSLSSRIAVIGPNGAGKSTLINVLTGEL--------------------
2ix3A           ------------------INFQCSLSSRIAVIGPNGAGKSTLINVLTGEL--------------------
2iwhB           ------------------INFQCSLSSRIAVIGPNGAGKSTLINVLTGEL--------------------
2iw3B           ------------------INFQCSLSSRIAVIGPNGAGKSTLINVLTGEL--------------------
2iw3A           ------------------INFQCSLSSRIAVIGPNGAGKSTLINVLTGEL--------------------
2cjwB           ---------------------------RVVLIGEQGVGKSTLANIFAGVETYERTLMVDGESATIILLDM


                         .         .         +         .         .         .         .:490
query           WRQHLSWVGQNPQLPAATLRENVLLARPDASEQELYAALDAAWVSEFLPLLPQGVDTPLGNHASRLSVGX
2hydA           LRNQIGLVQQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQ
3b60A           LRNQVALVSQNVHLFNDTVANNIAYARTEESREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSXXX
3g60A           LREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQ
3g5uA           LREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQ
1pf4A           LRRHFALVSQNVHLFNDTIANNIAYAAEEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSGGQ
1mv5D           WRSQIGFVSQDSAIMAGTIRENLTYGEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQ
1mv5A           WRSQIGFVSQDSAIMAGTIRENLTYGEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQ
2ghiA           IRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNKGMKLSGGE
1mt0A           LRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQ
2ff7A           LRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQ
2fgkA           LRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQ
2ffbA           LRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQ
3b5jA           LRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQ
2ghiC           IRSIIGIVPQDTILFNETIKYNILYGKLDATE-EVIKATKSAQLYDFIEALPKKWDTIVGG----MKLGE
1xefA           LRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQ
2ffaA           LRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQ
1z2rA           LRNQVALVSQNVHLFNDTVANNIAYARTEESREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSXXX
2ghiB           IRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGN-KMKLSGGE
1jj7A           LHRQVAAVGQEPQVFGRSLQENILTQKP--TMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQ
2ixfC           LHTQVAAVGQEPLLFGRSFRENIALTRTPTMEEITAVAMESG-AHDFISGFPQGYDTEVGETGNQLSGGQ
2ixfA           LHTQVAAVGQEPLLFGRSFRENIALTRTPTMEEITAVAMESG-AHDFISGFPQGYDTEVGETGNQLSGGQ
2ghiD           IRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGGERQRIAI--
2cbzA           ---SVAYVPQQAWIQNDSLRENILFGC-QLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQ
2ixgA           LHTQVAAVGQEPLLFGRSFRENIALTRTPTMEEITAVAMESG-AHDFISGFPQGYDTEVGETGNQLAVGQ
2ixeA           LHTQVAAVGQEPLLFGRSFRENIALTRTPTMEEITAVAMESG-AHDFISGFPQGYDTEVGETGNQLSGGQ
2ixfD           LHTQVAAVGQ--LLFGRSFRENIALTRTPTMEEITAVAMESG-AHDFISGFPQGYDTEVGETGNQLSGGQ
2ixeD           LHTQVAAVG--PLLFGRSFRENIALTRTPTMEEITAVAMESG-AHDFISGFPQGYDTEV-----QLSGGQ
3d31A           -KHDIAFVYQNYSLPHMNVKKNLEFGMRMKKIKDPKRVLDTARDLKIEHLLDRNPLTLSGGEQQRVALA-
1r10A           ---RVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1r0zD           ---RVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1r0zC           ---RVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1r0zB           ---RVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1r0zA           ---RVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1r0xD           ---RVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1r0xC           ---RVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1r0xB           ---RVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1r0xA           ---RVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1r0wC           ---RVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1r0wB           ---RVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1r0wA           ---RVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1q3hD           ---RVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1q3hC           ---RVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1q3hB           ---RVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1q3hA           ---RVSFCSQFSWIMPGTIKENIIFG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1xf9D           ---RVSFCSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1xf9C           ---RVSFCSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1xf9B           ---RVSFCSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1xf9A           ---RVSFCSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
2bbsB           ---RISFCSQNSWIMPGTIKENIIGVSYD--EYRYRSVIKACQLEEDISKFAEKDNIVLG--GITLSGGQ
1xfaA           ---RVSFCSQFSWIMPGTIKENIIRG-VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
2onkA           -RRGIGFVPQDYALPHLSVYRNIAYGLXXXXXXXXXXXXXX--MAEKL-----GIAHLLDRKPARLSGGE
2it1B           --RNVGLVFQNWALPHMTVYKNIALELRKAPREEIDKK-----VREVAKML--HIDKLLNRYPWQLSGGQ
2it1A           --RNVGLVFQNWALPHMTVYKNIALELRKAPREEIDKK-----VREVAKML--HIDKLLNRYPWQLSGGQ
1xmiE           ---RISFCSQFSWIMPGTIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQ
1xmiC           ---RISFCSQFSWIMPGTIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQ
1xmiA           ---RISFCSQFSWIMPGTIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQ
1xmjA           ---RISFCSQFSWIMPGTIKENIIGVSYD--EYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSEGQ
2bboA           ---RISFCSQFSWIMPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSEGQ
1g9xA           YHYGIVRTFQTPQLKEMTVLENLLIGEINPGESPLNSLFYKKWIPKEEEMVEKALSHLYDRKAGELSGGQ
2pzfB           ---RISFCSQFSWIMPGTIKENIIGVSYD--EYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQ
2pzfA           ---RISFCSQFSWIMPGTIKENIIGVSYD--EYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQ
2pzgA           ---RISFCSQFSWIMPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQ
2pzeB           ---RISFCSQFSWIMPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQ
2pzeA           ---RISFCSQFSWIMPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQ
2pjzA           -----NYIRYSTNLPEATVNDIVYL-------YEELKGLDRDLFLEMLKALKLGEEI-LRRKLYKLSAGQ
2ihyA           VRQHIGFVSHS-LLEKFQEGERVI-------DVVISGAIDDEIRNEAHQLLKLVGSAKAQQYIGYLSTG-
2bbtB           ---RISFCSQNSWIMPGTIKENIIGVSYD--EYRYRSVIKACQLEEDISKFAEKDNIVLG---ITLSGGQ
2bbtA           ---RISFCSQNSWIMPGTIKENIIGVSYD--EYRYRSVIKACQLEEDISKFAEKDNIVLG--GITLSGGQ
1v43A           --RNISMVFQH-----MTVYENIAFPLKKFPKDEIDKRV--RWAAELLQ-----IEELLNRYPAQLSGGX
2ihyB           VRQHIGFVSHS------------LLEKFQEGERVIDVVISGAFKSIG---VYQDIDDEIRNEAHQLYLST
1l2tB           LRDKIGFVFQQFNLPLLTALENVELRGAMSGEERRKRALECLKMAE--------LEERFANHPNQLSGGQ
1l2tA           LRDKIGFVFQQFNLPLLTALENVELRGAMSGEERRKRALECLKMAE--------LEERFANHPNQLSGGQ
1gajA           YHYGIVRTFQTPQLKEMTVLENLLIGEINPGESPLNSLFYKKWIPKEEEMVEKALSHLYDRKAGELSGGQ
1g6hA           YHYGIVRTFQTPQLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKALSHLYDRKAGELSGGQ
2bbsA           ---RISFCSQNSWIMPGTIKENIIGVSYD--EYRYRSVIKACQLEEDISKFAEKDNIVL----ITLSGGQ
1xmiD           ---RISFCSQFSWIMPGTIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGE--ITLSGGQ
2oukB           VREEVGMVFQRFNLPHMTVLNNITLAPREKAEAKAMELLDKVGLKDKAHAYP---DSLSGGQAQRVAIAR
2oljA           VREEVGMVFQRFNLPHMTVLNNITLAPREKAEAKAMELLDKVGLKDKAHAYP---DSLSGGQAQRVAIAR
2awoC           -----RGVGMVALYPHLSVAENMSFAKKEVINQRVNQVAEVLQLAHLLDRKPKALS---GGQRQRVAIGR
1xmiB           ---RISFCSQFSWIMPGTIKENI-IAGVSYDEYRYRSVIKACQLEEDISKI---VLTLSGGQRARISLA-
2pzgB           ---RISFCSQFSWIMPGTIKENIIFG-VSYDEYRYRSVIKACQLEEDISKFAEKDNIVLG---ITLSGGQ
3fvqB           RERRLGYLVQEGVLPHLTVYRNIAYGRTAQERQRIEAMLELTGISEL-----------AGRYPHELSGGX
3fvqA           RERRLGYLVQEGVLPHLTVYRNIAYGRTAQERQRIEAMLELTGISEL-----------AGRYPHELSGGX
2qi9C           LALHRAYLSQQQTPPFATVWHYLTLHQHDKTRTELLNDVAGA----------LALDDKLGRSTNQLSGGL
1q12A           --RGVGMVFQSYALPHLSVAENMSFAKKEVINQRVNQVAEVLQLAHLLDRKPKALS---GGQRQRVAIGR
3fh6A           --RGVGMVFQSYALPHLSVAENMSFAKKEVINQRVNQVAEVLQLAHLLDRKPKALS---GGQRQRVAIGR
2awoA           --RGVGMVFQSYALPHLSVAENMSFAKKEVINQRVNQVAEVLQLAHLLDRKPKALS---GGQRQRVAIGR
2awnB           --RGVGMVFQSYALPHLSVAENMSFAKKEVINQRVNQVAEVLQLAHLLDRKPKALS---GGQRQRVAIGR
2r6gB           --RGVGMVFQSYALPHLSVAENMSFAKKEVINQRVNQVAEVLQLAHLLDRKPKALS---GGQRQRVAIGR
2r6gA           --RGVGMVFQSYALPHLSVAENMSFAKKEVINQRVNQVAEVLQLAHLLDRKPKALS---GGQRQRVAIGR
3dhwC           LTKARRQIGMIFQ------HFNLLSSRTVFGNVALPLELDKRRVTELLSLV--GLGDKHDSYPSNLSGGQ
1l7vC           LALHRAYLSQQQTPPFATVWHYLTLHQHDKTRTELLNDVAGA----------LALDDKLGRSTNQLSGGL
2d2eA           ARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELL----DWDESYLSRYLNEGE
2pcjA           NRK-LGFVFQHYLIPELTALENVIVPMLKMGKPK----KEAKERGEYL-LSELGLGDKLSRKPYELSGGE
2yyzA           -YREVGMVFQNYALPHMTVFENI--AFPLRARRISKDEVEKRVVEIARKLL---IDNLLDRKPTQLSGGQ
1g291           DRD-IAMVFQSYALPHMTVYDNIALKLRKVPRQEIDQR-----VREVAELL--GLTELLNRKPRELSGGQ
2d2fA           ARKGLFLAFQYPEVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWD-ESYLSRYLNEGFSGG
1z47A           -KRNVGLVFQNYALQHMTVYDNVSFG---LREKRVPKDEMDARVRELLRFM--RLESYANRFPHELSGGX
1z47B           -KRNVGLVFQNYALQHMTVYDNVSFG---LREKRVPKDEMDARVRELLRFM--RLESYANRFPHELSGGX
1f3oA           LRDKIGFVFQQFNLPLLTALENVELPRGASGEERRKRALEC---------LKAELEERFANHKNQLSGGQ
2nq2D           FSSPFAYSVLDIVLMGRSTHINTF-AKPKSHDYQV-----AMQALDYLNL------THLAKRETSLSGGQ
2nq2C           FSSPFAYSVLDIVLMGRSTHINTF-AKPKSHDYQV-----AMQALDYLNL------THLAKRETSLSGGQ
1ji0A           INRGIALVPEGRRIPELTVYEN--LGAYNRKDKE-GIKRDLEWIFSLFPRLKERLKQTLSGGEQQLAIGR
1vplA           ----------------------------------------------------------------------
2zu0C           RAEGIFMAFQYPEIPGVSFLQTALNAVRSYRGQETLDRFDQDLMEEKIALLKMPEDLLTRSVNVGFSGGE
2d3wA           RAEGIFMAFQYPEIPGVSFLQTALNAVRSYRGQETLDRFDQDLMEEKIALLKMPEDLLTRSVNVGFSGGE
1oxvA           --RKIGMVFQTWALPNLTAFENIALTNMKMSKEEIRKRVEE--VAKILD-----IHHVLNHFPRELSGGQ
1oxsC           --RKIGMVFQTWALPNLTAFENIALTNMKMSKEEIRKRVEE--VAKILD-----IHHVLNHFPRELSGGQ
3gfoA           LRESIGIVFQDPQLFSASVYQDVSFGAVNMKEDEIRKRVDNA-------LKRTGIEHLKDKPTHCLSFGQ
2d3wB           RAEGIFMAFQYPEIPGVSFLQTALNAVRSYRGQETLDRFDQDLMEEKIALLKMPEDLLTRSVNVGFSGGE
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2cjwB           WENH------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           XXXXXXXXXXXNPCQLLLLDEPAASLDAHSEQRVMQALKAASKRQTTLMVTHQLEDLADWDAIWVMQDGA
2hydA           KQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTITHADKIVVIENGH
3b60A           XXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEQAXXXXXXXXXX
3g60A           KQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGV
3g5uA           KQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGV
1pf4A           RQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVIAHRLSTIEQADEILVVDEGE
1mv5D           RQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQ
1mv5A           RQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQ
2ghiA           RQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGK
1mt0A           RQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGK
2ff7A           RQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGK
2fgkA           RQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGK
2ffbA           RQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGK
3b5jA           RQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGK
2ghiC           RQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGK
1xefA           RQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTVKNADRIIVMEKGK
2ffaA           RQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTVKNADRIIVMEKGK
1z2rA           XXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTI-------------
2ghiB           RQRIAIARCLLKDPKIVIFDE--ATSDSKTEYLFQKAVEDLRKNRTLIIIAHR--TISSAESIILLNKGK
1jj7A           RQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERRSVLLITQHLSLVEQADHILFLEGGA
2ixfC           RQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPESRTVLLITHQLSLAERAHHILFLKEGS
2ixfA           RQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPESRTVLLITHQLSLAERAHHILFLKEGS
2ghiD           -------------ARCLLKDPKIVIFDDSKTEYLFQ--KAVEDNRTLIIIAHRLSTISSAESIILLNKGK
2cbzA           KQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGK
2ixgA           RQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPESRTVLLITQQLSLAERAHHILFLKEGS
2ixeA           RQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPESRTVLLITQQLSLAERAHHILFLKEGS
2ixfD           RQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPESRTVLLITHQLSLAERAHHILFLKEGS
2ixeD           RQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPESRTVLLITQQLSLAERAHHILFLKEGS
3d31A           ------RALVTNP-KILLLDEPLSALDPRTQENAREMLSVLHKKNTVLHITHQTEARIMADRIAVVMDGK
1r10A           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1r0zD           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1r0zC           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1r0zB           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1r0zA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1r0xD           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1r0xC           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1r0xB           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1r0xA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1r0wC           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1r0wB           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1r0wA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1q3hD           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1q3hC           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1q3hB           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1q3hA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1xf9D           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1xf9C           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1xf9B           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
1xf9A           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
2bbsB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
1xfaA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESVCKLMANKTRILVTSKMEHLRKADKILILHQGS
2onkA           RQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREVPILHVTHDLIEAAMLDEVAVMLNGR
2it1B           QQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELTTVYVTHQAEALAMADRIAVIREGE
2it1A           QQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELTTVYVTHQAEALAMADRIAVIREGE
1xmiE           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
1xmiC           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
1xmiA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
1xmjA           QAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
2bboA           QAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
1g9xA           MKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFHVLELKAKGITFLIIEHRLDIVLNYDHLYVMFNGQ
2pzfB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
2pzfA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
2pzgA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
2pzeB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
2pzeA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
2pjzA           SVLVRTSLALASQPEIVGLDEPFENVDAARRHVISRYIKEYGKE--GILVTHELDML-------------
2ihyA           -EKQRVIARALGQPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLYVTHFIEEIANFSKILLLKDGQ
2bbtB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
2bbtA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
1v43A           XXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKVTTIYVTHQVEAMTMGDRIAVMNRGQ
2ihyB           GEKQRVIARALGQPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLYVTHFIEEIANFSKILLLKDGQ
1l2tB           QQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEKTVVVVTHDINVARFGERIIYLKDGE
1l2tA           QQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEKTVVVVTHDINVARFGERIIYLKDGE
1gajA           MKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFHVLELKAKGITFLIIEHRLDIVLNYDHLYVMFNGQ
1g6hA           MKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFHVLELKAKGITFLIIEHRLDIVLNYDHLYVMFNGQ
2bbsA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
1xmiD           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
2oukB           ALAMEP--------KIMLFDEPTSALDPEMVGEVLSVMKLANEGMTMVVVTHEMGFAREGDRVLFMDGGY
2oljA           ALAMEP--------KIMLFDEPTSALDPEMVGEVLSVMKLANEGMTMVVVTHEMGFAREGDRVLFMDGGY
2awoC           TLVAEP--------SVFLLDEPLSNLDAALRVQMRIEISRLHKRRTMIYVTHQVEAMTLADKIVVLDAGR
1xmiB           -------RAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
2pzgB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
3fvqB           XXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAAANGKSAVFVSHDREEALQYDRIAVMKQGR
3fvqA           XXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAAANGKSAVFVSHDREEALQYDRIAVMKQGR
2qi9C           AAVVLQITPQANPAQLLLLDEP-NSLDVAQQSALDKILSALSQQGLAIVSSHDLHTLRHAHRAWLLKGGK
1q12A           TLVAEP--------SVFLLDEPLSNLDAALRVQMRIEISRLHKRRTMIYVTHQVEAMTLADKIVVLDAGR
3fh6A           TLVAEP--------SVFLLDEPLSNLDAALRVQMRIEISRLHKRRTMIYVTHQVEAMTLADKIVVLDAGR
2awoA           TLVAEP--------SVFLLDEPLSNLDAALRVQMRIEISRLHKRRTMIYVTHQVEAMTLADKIVVLDAGR
2awnB           TLVAEP--------SVFLLDEPLSNLDAALRVQMRIEISRLHKRRTMIYVTHQVEAMTLADKIVVLDAGR
2r6gB           TLVAEP--------SVFLLDQPLSNLDAALRVQMRIEISRLHKRRTMIYVTHQVEAMTLADKIVVLDAGR
2r6gA           TLVAEP--------SVFLLDQPLSNLDAALRVQMRIEISRLHKRRTMIYVTHQVEAMTLADKIVVLDAGR
3dhwC           KQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLTILLITHEMDVVKRCDCVAVISNGE
1l7vC           AAVVLQITPQANPAQLLLLDEP-NSLDVAQQSALDKILSALCQQGLAIVSSHDLHTLRHAHRAWLLKGGK
2d2eA           KKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNARGPNFGALVITHRILNYIQPDKVHVMMDGR
2pcjA           QQRVAIARALANEPILLFADEPTGNLDSANTKRVMDILKINEGGTSIVMVTHERELAELTHRTLEMKDGK
2yyzA           QQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELTSVYVTHQAEAMTMASRIAVFNQGK
1g291           RQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQVTTIYVTHQVEAMTMGDRIAVMNRGV
2d2fA           EKKRNEI------LQLLVLEPTYAVLDETDSGLDIDALKVVARGVNALVITHRILNYIQPDKVHVMMDGR
1z47A           XXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMTSVFVTHQEEALEVADRVLVLHEGN
1z47B           XXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMTSVFVTHQEEALEVADRVLVLHEGN
1f3oA           QQRVAIARALANNPPIILADEPTGALDSKTGEKI-QLLKKLNEEKTVVVVTHDINVARFGERIIYLKDGE
2nq2D           RQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLLAQSQNMTVVFTTHQ-----------------
2nq2C           RQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLLAQSQNMTVVFTTHQ-----------------
1ji0A           ALSRPK-----------LLDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQLGALKVAHYGYVLETGQ
1vplA           -----------NP-RLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSNMLEVEFLCDRIALIHNGT
2zu0C           KKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSRDGKRSFIIVTHRILDYIKPDYVHVLYQGR
2d3wA           KKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSRDGKRSFIIVTHRILDYIKPDYVHVLYQGR
1oxvA           QQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRVTLLVVSHDPADI-------------
1oxsC           QQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRVTLLVVSHDPADI-------------
3gfoA           KKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQKELGXXXXXXXXXXXLYCDNVFVMKEGR
2d3wB           KKRNDILQMAVLEPELCILDE-SDSLDIDALKVVADGVNSLGKRSFIIVTHYRILDYIKPDYVHVLYQGR
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           IVEQGSYAELSAANGAFATLLAHRQEDI
2hydA           IVETGTHRELIAKQGAYEHL--------
3b60A           XXXRGTHSELLAQHGVYAQL--------
3g60A           IVEQGNHDELMREKGIYFKLV-------
3g5uA           IVEQGNHDELMREKGIYFKLV-------
1pf4A           IIERGRHAD-------------------
1mv5D           ITGSGKHNELVATHPLYAKYVSEQ----
1mv5A           ITGSGKHNELVATHPLYAKYVSEQ----
2ghiA           IVEKGTHKDLLKLNGEYAEM--------
1mt0A           IVEQGKH---------------------
2ff7A           IVEQGKH---------------------
2fgkA           IVEQGKH---------------------
2ffbA           IVEQGKH---------------------
3b5jA           IVEQGKH---------------------
2ghiC           IVEKGTHKDLLKLNGEYAEM--------
1xefA           IVEQGKH---------------------
2ffaA           IVEQGKH---------------------
1z2rA           ----------------------------
2ghiB           IVEKGTHKDLLKLNGEYAEM--------
1jj7A           IREGGTHQQLMEKKGCY-----------
2ixfC           VCEQGTHLQLMERGGCYRSMV-------
2ixfA           VCEQGTHLQLMERGGCYRSMV-------
2ghiD           IVEKGTHKDLLKLNGEYAEM--------
2cbzA           ISEMGSYQELLARDGAFAEFL-------
2ixgA           VCEQGTHLQLMERGGCYRSMV-------
2ixeA           VCEQGTHLQLMERGGCYRSMV-------
2ixfD           VCEQGTHLQLMERGGCYRSMV-------
2ixeD           VCEQGTHLQLMERGGCYRSMV-------
3d31A           LIQVGKPEEI------------------
1r10A           SYFYGTFSELQSLRPDFSSKL-------
1r0zD           SYFYGTFSELQSLRPDFSSKL-------
1r0zC           SYFYGTFSELQSLRPDFSSKL-------
1r0zB           SYFYGTFSELQSLRPDFSSKL-------
1r0zA           SYFYGTFSELQSLRPDFSSKL-------
1r0xD           SYFYGTFSELQSLRPDFSSKL-------
1r0xC           SYFYGTFSELQSLRPDFSSKL-------
1r0xB           SYFYGTFSELQSLRPDFSSKL-------
1r0xA           SYFYGTFSELQSLRPDFSSKL-------
1r0wC           SYFYGTFSELQSLRPDFSSKL-------
1r0wB           SYFYGTFSELQSLRPDFSSKL-------
1r0wA           SYFYGTFSELQSLRPDFSSKL-------
1q3hD           SYFYGTFSELQSLRPDFSSKL-------
1q3hC           SYFYGTFSELQSLRPDFSSKL-------
1q3hB           SYFYGTFSELQSLRPDFSSKL-------
1q3hA           SYFYGTFSELQSLRPDFSSKL-------
1xf9D           SYFYGTFSELQSLRPDFSSKL-------
1xf9C           SYFYGTFSELQSLRPDFSSKL-------
1xf9B           SYFYGTFSELQSLRPDFSSKL-------
1xf9A           SYFYGTFSELQSLRPDFSSKL-------
2bbsB           SYFYGTFSELQNLRDSFDQFSAERRNSI
1xfaA           SYFYGTFSELQSLRPDFSSKL-------
2onkA           IVEKGKLKELSAKNGEVAEFLSAR----
2it1B           ILQVGTPDEV------------------
2it1A           ILQVGTPDEV------------------
1xmiE           SYFYGTFSELQNLQPDFSSKL-------
1xmiC           SYFYGTFSELQNLQPDFSSKL-------
1xmiA           SYFYGTFSELQNLQPDFSSKL-------
1xmjA           SYFYGTFSELQNLQPDFSSKL-------
2bboA           SYFYGTFSELQNLQPDFSSKL-------
1g9xA           IIAEG-----------------------
2pzfB           SYFYGTFSEL------------------
2pzfA           SYFYGTFSEL------------------
2pzgA           SYFYGTFSEL------------------
2pzeB           SYFYGTFSEL------------------
2pzeA           SYFYGTFSEL------------------
2pjzA           ----------------------------
2ihyA           SIQQGAVEDLTSENSRF-----------
2bbtB           SYFYGTFSELQNLRPDFSSKL-------
2bbtA           SYFYGTFSEL------------------
1v43A           LLQIGSPTEV------------------
2ihyB           SIQQGAVEDLTSENSRF-----------
1l2tB           V---------------------------
1l2tA           V---------------------------
1gajA           IIAEG-----------------------
1g6hA           IIAEG-----------------------
2bbsA           SYFYGTFSELQNLRPDFSSKL-------
1xmiD           SYFYGTFSELQNLQPDFSSKL-------
2oukB           IIEEGKPEDL------------------
2oljA           IIEEGKPEDL------------------
2awoC           VAQVGKPLEL------------------
1xmiB           SYFYGTFSELQNLQPDFSSKL-------
2pzgB           SYFYGTFSEL------------------
3fvqB           ILQTASPHEL------------------
3fvqA           ILQTASPHEL------------------
2qi9C           L---------------------------
1q12A           VAQVGKPLEL------------------
3fh6A           VAQVGKPLEL------------------
2awoA           VAQVGKPLEL------------------
2awnB           VAQVGKPLEL------------------
2r6gB           VAQVGKPLEL------------------
2r6gA           VAQVGKPLEL------------------
3dhwC           LIEQDTVSEV------------------
1l7vC           L---------------------------
2d2eA           VVATG-----------------------
2pcjA           VV--------------------------
2yyzA           LVQYGTPDEV------------------
1g291           LQQVGSPDEV------------------
2d2fA           VVATG-----------------------
1z47A           VEQFGTPEEV------------------
1z47B           VEQFGTPEEV------------------
1f3oA           V---------------------------
2nq2D           ----------------------------
2nq2C           ----------------------------
1ji0A           IVLEGKASEL------------------
1vplA           IVETGTVEEL------------------
2zu0C           IVKSGDF---------------------
2d3wA           IVKSGDF---------------------
1oxvA           ----------------------------
1oxsC           ----------------------------
3gfoA           VILQGNPKEVFA----------------
2d3wB           IVKSGDF---------------------
2d3wD           ----------------------------
2d3wC           ----------------------------
2ix8A           ----------------------------
2ix3A           ----------------------------
2iwhB           ----------------------------
2iw3B           ----------------------------
2iw3A           ----------------------------
2cjwB           ----------------------------