[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF67239.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2k9sA.bssp"

## Summary of PDB Search
:309
    1e-04  30%  2k9sA  [x.x.x] ARABINOSE OPERON REGULATORY PROTEIN
:309

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2k9sA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2k9sA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2k9sA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxLTDVADHIFMSTSTLKRKLAEEGTSFSDIYLSARMNQAAKLLRIGNHNVNAVALKC
2k9sA           --------------IASVAQHVCLSPSRLSHLFRQQGISVLSWREDQRISQAKLLLSTTRMPIATVGRNV


                         .         *         .         .         .         .         +:350
query           GYDSTSYFIQCFKKYFKTTPSTFxxxxxx
2k9sA           GFDDQLYFSRVFKKCTGASPSEF------