[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:gloA

[Show Plain Result]

#ERROR : Can't open dsspfile "1f9zA.bssp"
#ERROR : Can't open dsspfile "2c21A.bssp"
#ERROR : Can't open dsspfile "1qipB.bssp"
#ERROR : Can't open dsspfile "1qipA.bssp"
#ERROR : Can't open dsspfile "2za0B.bssp"
#ERROR : Can't open dsspfile "2za0A.bssp"
#ERROR : Can't open dsspfile "1bh5B.bssp"
#ERROR : Can't open dsspfile "1bh5A.bssp"

## Summary of PDB Search
:135
    3e-66  92%  1f9zA  [d.32.1] GLYOXALASE I
    5e-32  55%  2c21A  [x.x.x] TRYPANOTHIONE-DEPENDENT GLYOXALASE I
    2e-20  44%  1qipB  [d.32.1] PROTEIN (LACTOYLGLUTATHIONE LYASE)
    2e-20  44%  1qipA  [d.32.1] PROTEIN (LACTOYLGLUTATHIONE LYASE)
    3e-20  43%  2za0B  [x.x.x] GLYOXALASE I
    3e-20  43%  2za0A  [x.x.x] GLYOXALASE I
    5e-20  43%  1bh5B  [d.32.1] LACTOYLGLUTATHIONE LYASE
    5e-20  43%  1bh5A  [d.32.1] LACTOYLGLUTATHIONE LYASE
:135

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVESYDMGN
1f9zA           MRLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGT
2c21A           -RMLHTMIRVGDLDRSIKFYTERLGMKVLRKWDVPEDKYTLVFLGYGPEMSSTVLELTYNYGVTSYKHDE
1qipB           --LQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDKATLELTHNWGTESYHNGN
1qipA           --LQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDKATLELTHNWGTESYHNGN
2za0B           --LQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKNDKATLELTHNWGTESYHNGN
2za0A           --LQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKNDKATLELTHNWGTESYHNGN
1bh5B           --LQETMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDKATLELTHNWGTESYHNGN
1bh5A           --LQETMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDKATLELTHNWGTESYHNGN


                         .         .         *         .         .         .         .:140
query           AYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYKIELIEAKxxxxxxxx
1f9zA           AYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIELIE----------
2c21A           AYGHIAIGVEDVKELVADMRKHDVPIDYE-----DESGFMAFVVDPDGYYIELLNEK--------
1qipB           SFGHIGIAVPDVYSACKRFEELGVKFVKK--PDDGKMKGLAFIQDPDGYWIEIL-----------
1qipA           SFGHIGIAVPDVYSACKRFEELGVKFVKK--PDDGKMKGLAFIQDPDGYWIEIL-----------
2za0B           SFGHIGIAVPDVYSACKRFEELGVKFVKK--PDDGKMKGLAFIQDPDGYWIEIL-----------
2za0A           SFGHIGIAVPDVYSACKRFEELGVKFVKK--PDDGKMKGLAFIQDPDGYWIEIL-----------
1bh5B           SFGHIGIAVPDVYSACKRFEELGVKFVKK--PDDGKMKGLAFIQDPDGYWIQIL-----------
1bh5A           SFGHIGIAVPDVYSACKRFEELGVKFVKK--PDDGKMKGLAFIQDPDGYWIQIL-----------