[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF67354.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vh9A.bssp"
#ERROR : Can't open dsspfile "1vi8G.bssp"
#ERROR : Can't open dsspfile "1vi8B.bssp"
#ERROR : Can't open dsspfile "1vh5A.bssp"
#ERROR : Can't open dsspfile "1sbkA.bssp"
#ERROR : Can't open dsspfile "1o0iA.bssp"
#ERROR : Can't open dsspfile "2b6eD.bssp"
#ERROR : Can't open dsspfile "2b6eB.bssp"
#ERROR : Can't open dsspfile "2b6eA.bssp"
#ERROR : Can't open dsspfile "1q4uB.bssp"
#ERROR : Can't open dsspfile "1q4uA.bssp"
#ERROR : Can't open dsspfile "1q4sB.bssp"
#ERROR : Can't open dsspfile "1q4sA.bssp"

## Summary of PDB Search
:137
    2e-66  91%  1vh9A  [d.38.1] HYPOTHETICAL PROTEIN YBDB
    2e-38  51%  1vi8G  [d.38.1] HYPOTHETICAL PROTEIN YDII
    2e-38  51%  1vi8B  [d.38.1] HYPOTHETICAL PROTEIN YDII
    2e-38  51%  1vh5A  [d.38.1] HYPOTHETICAL PROTEIN YDII
    2e-34  52%  1sbkA  [d.38.1] HYPOTHETICAL PROTEIN YDII
    1e-25  42%  1o0iA  [d.38.1] HYPOTHETICAL PROTEIN HI1161
    1e-25  42%  2b6eD  [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161
    1e-25  42%  2b6eB  [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161
    1e-25  42%  2b6eA  [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161
    2e-06  24%  1q4uB  [d.38.1] THIOESTERASE
    2e-06  24%  1q4uA  [d.38.1] THIOESTERASE
    2e-06  24%  1q4sB  [d.38.1] THIOESTERASE
    2e-06  24%  1q4sA  [d.38.1] THIOESTERASE
:137

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXETLGSMAG
1vh9A           LIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTRTHQPFXXXXXXXXXXXXETLGSMAG
1vi8G           LIWKRKITLEALNAMGEGNMVGFLDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVVLAESIGSVAG
1vi8B           LIWKRKITLEALNAMGEGNMVGFLDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVVLAESIGSVAG
1vh5A           LIWKRKITLEALNAMGEGNMVGFLDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVVLAESIGSVAG
1sbkA           -IWKRKITLEALNAGEGN--VGFLDIRFEHIGDDTLEAT-PVDSRTKQPFGLLHGGASVVLAESIGSVAG
1o0iA           -LWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDWIEAT-PVDHRT-QPFGVLHGGVSVALAETIGSLAG
2b6eD           -LWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDWIEAT-PVDHRT-QPFGVLHGGVSVALAETIGSLAG
2b6eB           -LWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDWIEAT-PVDHRT-QPFGVLHGGVSVALAETIGSLAG
2b6eA           -LWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDWIEAT-PVDHRT-QPFGVLHGGVSVALAETIGSLAG
1q4uB           ----------------EQTLDGTVGFVIDEMTPERATASVEVTDTLRQRWGLVHGGAYCALAEMLATEAT
1q4uA           ----------------EQTLDGTVGFVIDEMTPERATASVEVTDTLRQRWGLVHGGAYCALAEMLATEAT
1q4sB           ----------------EQTLDGTVGFVIDEMTPERATASVEVTDTLRQRWGLVHGGAYCALAEMLATEAT
1q4sA           ----------------EQTLDGTVGFVIDEMTPERATASVEVTDTLRQRWGLVHGGAYCALAEMLATEAT


                         .         .         *         .         .         .         .:140
query           YLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDEQGRRCCTCRLGTAVMG
1vh9A           FMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQPLHLGRQNQSWEIVVFDEQGRRCCTCRLGTAVLG
1vi8G           YLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFDEKGRLCCSSRLTTAIL-
1vi8B           YLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFDEKGRLCCSSRLTTAIL-
1vh5A           YLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFDEKGRLCCSSRLTTAIL-
1sbkA           YLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFDEKGRLCCSSRLTTAIL-
1o0iA           SLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTEENKLCCVSRLTLSVI-
2b6eD           SLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTEENKLCCVSRLTLSVI-
2b6eB           SLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTEENKLCCVSRLTLSVI-
2b6eA           SLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTEENKLCCVSRLTLSVI-
1q4uB           VAVVHEGMMAVGQSNHTSFFRPVKEGHVRAEAVRIHAGSTTWFWDVSLRDDAGRLCAVSSMSIAV--
1q4uA           VAVVHEGMMAVGQSNHTSFFRPVKEGHVRAEAVRIHAGSTTWFWDVSLRDDAGRLCAVSSMSIAV--
1q4sB           VAVVHEGMMAVGQSNHTSFFRPVKEGHVRAEAVRIHAGSTTWFWDVSLRDDAGRLCAVSSMSIAV--
1q4sA           VAVVHEGMMAVGQSNHTSFFRPVKEGHVRAEAVRIHAGSTTWFWDVSLRDDAGRLCAVSSMSIAV--