[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF67435.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3hhgG.bssp"
#ERROR : Can't open dsspfile "3hhgE.bssp"
#ERROR : Can't open dsspfile "3hhgC.bssp"
#ERROR : Can't open dsspfile "3hhgB.bssp"
#ERROR : Can't open dsspfile "3hhgA.bssp"
#ERROR : Can't open dsspfile "3hhfA.bssp"
#ERROR : Can't open dsspfile "3hhfB.bssp"
#ERROR : Can't open dsspfile "3fzvB.bssp"
#ERROR : Can't open dsspfile "3fzvC.bssp"
#ERROR : Can't open dsspfile "1iz1B.bssp"
#ERROR : Can't open dsspfile "1iz1A.bssp"

## Summary of PDB Search
:302
    2e-39  35%  3hhgG  [x.x.x] TRANSCRIPTIONAL REGULATOR, LYSR FAMILY
    2e-39  35%  3hhgE  [x.x.x] TRANSCRIPTIONAL REGULATOR, LYSR FAMILY
    2e-39  35%  3hhgC  [x.x.x] TRANSCRIPTIONAL REGULATOR, LYSR FAMILY
    2e-39  35%  3hhgB  [x.x.x] TRANSCRIPTIONAL REGULATOR, LYSR FAMILY
    2e-39  35%  3hhgA  [x.x.x] TRANSCRIPTIONAL REGULATOR, LYSR FAMILY
    8e-18  34%  3hhfA  [x.x.x] TRANSCRIPTIONAL REGULATOR, LYSR FAMILY
    2e-15  33%  3hhfB  [x.x.x] TRANSCRIPTIONAL REGULATOR, LYSR FAMILY
    3e-08  28%  3fzvB  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR
    1e-07  30%  3fzvC  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR
    3e-05  47%  1iz1B  [a.4.5 - c.94.1] LYSR-TYPE REGULATORY PROTEIN
    3e-05  47%  1iz1A  [a.4.5 - c.94.1] LYSR-TYPE REGULATORY PROTEIN
:302

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxLEAMNIYVNVVEQGSFIRAAEVLELHRPAVTRAVQNLEHDLGVKLLHRTTRQVSMTDEGEEFYQR
3hhgG           ------EELTVFVQVVESGSFSRAAEQLAMANSAVSRIVKRLEEKLGVNLLNRTTRQLSLTEEGAQYFRR
3hhgE           ------EELTVFVQVVESGSFSRAAEQLAMANSAVSRIVKRLEEKLGVNLLNRTTRQLSLTEEGAQYFRR
3hhgC           ------EELTVFVQVVESGSFSRAAEQLAMANSAVSRIVKRLEEKLGVNLLNRTTRQLSLTEEGAQYFRR
3hhgB           ------EELTVFVQVVESGSFSRAAEQLAMANSAVSRIVKRLEEKLGVNLLNRTTRQLSLTEEGAQYFRR
3hhgA           ------EELTVFVQVVESGSFSRAAEQLAMANSAVSRIVKRLEEKLGVNLLNRTTRQLSLTEEGAQYFRR
3hhfA           ----------------------------------------------------------------------
3hhfB           ----------------------------------------------------------------------
3fzvB           -----LRQLKYFVTTVECGSVAEASRKLYIAQPSISTAVKGLEESFGVQLF-------SLTPAGARFYRK
3fzvC           -----LRQLKYFVTTVECGSVAEASRKLYIAQPSISTAVKGLEESFGVQLF-------SLTPAGARFYRK
1iz1B           ---------------------------LHVSQPPITRQMQALEADLGVVLLERSHRGIELTAAGHAF---
1iz1A           ---------------------------LHVSQPPITRQMQALEADLGVVLLERSHRGIELTAAGHAF---


                         .         .         *         .         .         .         .:140
query           CLSLLSELDDVRRLFSSTQPPKGRLRLDVPITLARAVIIPALGDFQNRYPDIEIVLGTSDRKIDLIAERV
3hhgG           AQRILQEMAAAEEMLAVHEIPQGVLSVDSAMPMVLHLLAPLAAKFNERYPHIRLSLVSSEGYINLIERKV
3hhgE           AQRILQEMAAAEEMLAVHEIPQGVLSVDSAMPMVLHLLAPLAAKFNERYPHIRLSLVSSEGYINLIERKV
3hhgC           AQRILQEMAAAEEMLAVHEIPQGVLSVDSAMPMVLHLLAPLAAKFNERYPHIRLSLVSSEGYINLIERKV
3hhgB           AQRILQEMAAAEEMLAVHEIPQGVLSVDSAMPMVLHLLAPLAAKFNERYPHIRLSLVSSEGYINLIERKV
3hhgA           AQRILQEMAAAEEMLAVHEIPQGVLSVDSAMPMVLHLLAPLAAKFNERYPHIRLSLVSSEGYINLIERKV
3hhfA           --------------------------------------------FNERYPHIRLSLVSSEGYINLIERKV
3hhfB           --------------------------------------------FNERYPHIRLSLVSSEGYINLIERKV
3fzvB           AQELLRAHEFEQNALADNDVIAGQIDIGCFETVAPLYLPGLIAGFRQAYPGVEI----------------
3fzvC           AQELLRAHE-----FEQNDVIAGQIDIGCFETVAPLYLPGLIAGFRQAYPGVEI----------------
1iz1B           -------LEDARRI--------------------------------------------------------
1iz1A           -------LEDARRI--------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DCVIRLGELNDSSFVARRLGTAAMVTCAAPSYLAKHGTPHSIDELMKSHRAVNFFSNHSLQIMEWKFTVD
3hhgG           DIALRAGELDDSGLRARHLFDSRFRVIASPEYLAKHGTPQSTEEL-AGHQCLGFTEPGSLN--TWA-VLD
3hhgE           DIALRAGELDDSGLRARHLFDSRFRVIASPEYLAKHGTPQSTEEL-AGHQCLGFTEPGSLN--TWA-VLD
3hhgC           DIALRAGELDDSGLRARHLFDSRFRVIASPEYLAKHGTPQSTEEL-AGHQCLGFTEPGSLN--TWA-VLD
3hhgB           DIALRAGELDDSGLRARHLFDSRFRVIASPEYLAKHGTPQSTEEL-AGHQCLGFTEPGSLN--TWA-VLD
3hhgA           DIALRAGELDDSGLRARHLFDSRFRVIASPEYLAKHGTPQSTEEL-AGHQCLGFTEPGSLN--TWA-VLD
3hhfA           DIALRAGELDDSGLRARHLFDSRFRVIASPEYLAKHGTPQSTEEL-AGHQCLGFTEPGSLN--TWA-VLD
3hhfB           DIALRAGD--DSGLRARHLFDSRFRVIASPEYLAKHGTPQSTEEL-AGHQCLGFTEPGSLN--TWA-VLD
3fzvB           ----------------------------------------------------------------------
3fzvC           ----------------------------------------------------------------------
1iz1B           ----------------------------------------------------------------------
1iz1A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GSIASIKIPSSILVDNSEAFLSCGLAGLGVLHGLRPSLAPFIASGELTEILTDFXXXXXXVSLLYPDRRY
3hhgG           AQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSDFLVDNDIAEGKLIPLLAETSDKTHPFNAVYYSDKA
3hhgE           AQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSDFLVDNDIAEGKLIPLLAETSDKTHPFNAVYYSDKA
3hhgC           AQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSDFLVDNDIAEGKLIPLLAETSDKTHPFNAVYYSDKA
3hhgB           AQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSDFLVDNDIAEGKLIPLLAETSDKTHPFNAVYYSDKA
3hhgA           AQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSDFLVDNDIAEGKLIPLLAETSDKTHPFNAVYYSDKA
3hhfA           AQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSDFLVDNDIAEGKLIPLLAETSDKTHPFNAVYYSDKA
3hhfB           AQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSDFLVDNDIAEGKLIPLLAETSDKTHPFNAVYYSDKA
3fzvB           ----------------------------------------------------------------------
3fzvC           ----------------------------------------------------------------------
1iz1B           ----------------------------------------------------------------------
1iz1A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LAPKVRVFIDWLCEVFGxxxxx
3hhgG           VNLRLRVFLDFLVEELG-----
3hhgE           VNLRLRVFLDFLVEELG-----
3hhgC           VNLRLRVFLDFLVEELG-----
3hhgB           VNLRLRVFLDFLVEELG-----
3hhgA           VNLRLRVFLDFLVEELG-----
3hhfA           VNLRLRVFLDFLVEELG-----
3hhfB           VNLRLRVFLDFLVEELG-----
3fzvB           ----------------------
3fzvC           ----------------------
1iz1B           ----------------------
1iz1A           ----------------------