[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF67448.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ggmB.bssp"
#ERROR : Can't open dsspfile "3ggmA.bssp"
#ERROR : Can't open dsspfile "3icjA.bssp"
#ERROR : Can't open dsspfile "3etkA.bssp"
#ERROR : Can't open dsspfile "1v4yA.bssp"
#ERROR : Can't open dsspfile "1rjqA.bssp"
#ERROR : Can't open dsspfile "1m7jA.bssp"
#ERROR : Can't open dsspfile "3ighX.bssp"
#ERROR : Can't open dsspfile "1gkrA.bssp"
#ERROR : Can't open dsspfile "3h4uA.bssp"
#ERROR : Can't open dsspfile "3e74C.bssp"
#ERROR : Can't open dsspfile "3e74B.bssp"
#ERROR : Can't open dsspfile "3feqO.bssp"
#ERROR : Can't open dsspfile "3feqN.bssp"
#ERROR : Can't open dsspfile "3feqL.bssp"
#ERROR : Can't open dsspfile "3feqK.bssp"
#ERROR : Can't open dsspfile "3feqJ.bssp"
#ERROR : Can't open dsspfile "3feqC.bssp"
#ERROR : Can't open dsspfile "3feqA.bssp"
#ERROR : Can't open dsspfile "3e74A.bssp"
#ERROR : Can't open dsspfile "2g3fA.bssp"
#ERROR : Can't open dsspfile "2bb0A.bssp"
#ERROR : Can't open dsspfile "1nfgA.bssp"
#ERROR : Can't open dsspfile "2r8cF.bssp"
#ERROR : Can't open dsspfile "2r8cD.bssp"
#ERROR : Can't open dsspfile "2r8cB.bssp"
#ERROR : Can't open dsspfile "2r8cA.bssp"
#ERROR : Can't open dsspfile "1gkpA.bssp"

## Summary of PDB Search
:566
    7e-14  49%  3ggmB  [x.x.x] UNCHARACTERIZED PROTEIN BT9727_2919
    7e-14  49%  3ggmA  [x.x.x] UNCHARACTERIZED PROTEIN BT9727_2919
    1e-10  25%  3icjA  [x.x.x] UNCHARACTERIZED METAL-DEPENDENT HYDROLASE
    3e-10  25%  3etkA  [x.x.x] UNCHARACTERIZED METAL-DEPENDENT HYDROLASE
    9e-07  39%  1v4yA  [b.92.1 - c.1.9 - b.92.1] D-AMINOACYLASE
    9e-07  39%  1rjqA  [b.92.1 - c.1.9 - b.92.1] D-AMINOACYLASE
    9e-07  39%  1m7jA  [b.92.1 - c.1.9 - b.92.1] D-AMINOACYLASE
    4e-06  26%  3ighX  [x.x.x] UNCHARACTERIZED METAL-DEPENDENT HYDROLASE
    1e-05  40%  1gkrA  [b.92.1 - c.1.9] NON-ATP DEPENDENT L-SELECTIVE HYDANTOINASE
    3e-05  35%  3h4uA  [x.x.x] AMIDOHYDROLASE
    6e-05  41%  3e74C  [x.x.x] ALLANTOINASE
    6e-05  41%  3e74B  [x.x.x] ALLANTOINASE
    1e-04  34%  3feqO  [x.x.x] PUTATIVE AMIDOHYDROLASE
    1e-04  34%  3feqN  [x.x.x] PUTATIVE AMIDOHYDROLASE
    1e-04  34%  3feqL  [x.x.x] PUTATIVE AMIDOHYDROLASE
    1e-04  34%  3feqK  [x.x.x] PUTATIVE AMIDOHYDROLASE
    1e-04  34%  3feqJ  [x.x.x] PUTATIVE AMIDOHYDROLASE
    1e-04  34%  3feqC  [x.x.x] PUTATIVE AMIDOHYDROLASE
    1e-04  34%  3feqA  [x.x.x] PUTATIVE AMIDOHYDROLASE
    1e-04  43%  3e74A  [x.x.x] ALLANTOINASE
    1e-04  34%  2g3fA  [x.x.x] IMIDAZOLONEPROPIONASE
    1e-04  34%  2bb0A  [x.x.x] IMIDAZOLONEPROPIONASE
    2e-04  41%  1nfgA  [b.92.1 - c.1.9] D-HYDANTOINASE
    7e-04  41%  2r8cF  [x.x.x] PUTATIVE AMIDOHYDROLASE
    7e-04  41%  2r8cD  [x.x.x] PUTATIVE AMIDOHYDROLASE
    7e-04  41%  2r8cB  [x.x.x] PUTATIVE AMIDOHYDROLASE
    7e-04  41%  2r8cA  [x.x.x] PUTATIVE AMIDOHYDROLASE
    0.001  39%  1gkpA  [b.92.1 - c.1.9] HYDANTOINASE
:566

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDIILHNGNIITLNDAQPQASALAISGSRIVAIGDDTATD
3ggmB           -------------------------------DMILYNGKITTLDPSQPEVSAIAITDGLITAVGGDELLN
3ggmA           -------------------------------DMILYNGKITTLDPSQPEVSAIAITDGLITAVGGDELLN
3icjA           ----------------------------------LINGTIYTSFSPVKKVSGLVISNERVLYAGDSSTAA
3etkA           ----------------------------------LINGTIYTSFSPVKKVSGLVISNERVLYAGDSSTAA
1v4yA           -------------------------------DYILSGGTVIDGTNAPGRLADVGVRGDRIAAVGDLSASS
1rjqA           -------------------------------DYILSGGTVIDGTNAPGRLADVGVRGDRIAAVGDLSASS
1m7jA           -------------------------------DYILSGGTVIDGTNAPGRLADVGVRGDRIAAVGDLSASS
3ighX           ----------------------------------LINGTIYTSFNPLKKVSGLVISHGKVIYAGDSEVAK
1gkrA           -------------------------------DVIVKNCRLVS-SDGITEADILVKDG-KVAAISADTSDV
3h4uA           --------------------------------LVKHADVLVTMDDTRRELAGLYIEDNRIVAVGPSAELP
3e74C           -------------------------------DLIIKNGTVILENEA--RVVDIAVKGGKIAAIGQDL---
3e74B           -------------------------------DLIIKNGTVILENEA--RVVDIAVKGGKIAAIGQDL---
3feqO           ---------------------------------VLQGGNVLDLEGVLLEHHHVVIDGERIVEVTDRPVDL
3feqN           ---------------------------------VLQGGNVLDLEGVLLEHHHVVIDGERIVEVTDRPVDL
3feqL           ---------------------------------VLQGGNVLDLEGVLLEHHHVVIDGERIVEVTDRPVDL
3feqK           ---------------------------------VLQGGNVLDLEGVLLEHHHVVIDGERIVEVTDRPVDL
3feqJ           ---------------------------------VLQGGNVLDLEGVLLEHHHVVIDGERIVEVTDRPVDL
3feqC           ---------------------------------VLQGGNVLDLEGVLLEHHHVVIDGERIVEVTDRPVDL
3feqA           ---------------------------------VLQGGNVLDLEGVLLEHHHVVIDGERIVEVTDRPVDL
3e74A           -------------------------------DLIIKNGTVILENEA--RVVDIAVKGGKIAAIGQDL---
2g3fA           --------------------------------ILINIGQLLTMESSGPRAAVVGIHEQKIVFAGQKGAEA
2bb0A           --------------------------------ILINIGQLLTMESSGPRAAVVGIHEQKIVFAGQKGAEA
1nfgA           -------------------------------DIIIKNGTIVTADGIS--RADLGIKDGKITQIGGALGPA
2r8cF           ----------------------------------------------------------------------
2r8cD           ----------------------------------------------------------------------
2r8cB           ----------------------------------------------------------------------
2r8cA           ----------------------------------------------------------------------
1gkpA           --------------------------------LLIKNGEIITA-DSRYKADIYA-EGETITRIGQNLEAP


                         .         .         *         .         .         .         .:140
query           EWRGDHTRTIDLQGKTVIPGLTDTHIHAIRGGQTWTFETYWYDSPSLKDALDKLRADANRRPHDQWVAVV
3ggmB           S-ATEKTKKIDLKRKRAIPGLNDSHIHVIRG---------------------------------------
3ggmA           S-ATEKTKKIDLKRKRAIPGLNDSHIHVIRG---------------------------------------
3icjA           ELAGGEI--IDLKGKFVMPAFFDSHLHLDELGMSLEMVDL-RGVKSMEELVERVKKGRGR--------II
3etkA           ELAGGEI--IDLKGKFVMPAFFDSHLHLDELGMSLEMVDL-RGVKSMEELVERVKKGRGR--------II
1v4yA           A-----RRRIDVAGKVVSPGFIDSHTH-------------------------------------------
1rjqA           A-----RRRIDVAGKVVSPGFIDSHTH-------------------------------------------
1m7jA           A-----RRRIDVAGKVVSPGFIDSHTH-------------------------------------------
3ighX           ELSGGEI--VDLKGKYVMPAFFDSHLHLDELGMSLEMVDL-RGAKSIEELIQRLKRGKGR------IIFG
1gkrA           E----ASRTIDAGGKFVMPGVVDEHVHII-----------------------------------------
3h4uA           ETADE---VLDLRGHLVIPGLVNTHHH-------------------------------------------
3e74C           ---GD-AKEVDASGLVVSPGV-DAHTHIYETG--------------------------------------
3e74B           ---GD-AKEVDASGLVVSPGVAHTHISHWEGYETGT----------------------------------
3feqO           P----NAQAIDVRGKTVMPGFIDCHVHVL-----------------------------------------
3feqN           P----NAQAIDVRGKTVMPGFIDCHVHVL-----------------------------------------
3feqL           P----NAQAIDVRGKTVMPGFIDCHVHVL-----------------------------------------
3feqK           P----NAQAIDVRGKTVMPGFIDCHVHVL-----------------------------------------
3feqJ           P----NAQAIDVRGKTVMPGFIDCHVHVL-----------------------------------------
3feqC           P----NAQAIDVRGKTVMPGFIDCHVHVL-----------------------------------------
3feqA           P----NAQAIDVRGKTVMPGFIDCHVHVL-----------------------------------------
3e74A           ---GD-AKEVDASGLVVSPGV-DAHTH-------------------------------------------
2g3fA           GYEADEI--IDCSGRLVTPGLVDPHTHLVFGG--------------------------------------
2bb0A           GYEADEI--IDCSGRLVTPGLVDPHTHLVFGG--------------------------------------
1nfgA           E------RTIDAAGRYVFPGGIDVHTHV----ETVSFNT-------------------------------
2r8cF           --KSSNAHVIDVKGKTIMPGLIDLHVHVV-----------------------------------------
2r8cD           --KSSNAHVIDVKGKTIMPGLIDLHVHVV-----------------------------------------
2r8cB           --KSSNAHVIDVKGKTIMPGLIDLHVHVV-----------------------------------------
2r8cA           --KSSNAHVIDVKGKTIMPGLIDLHVHVV-----------------------------------------
1gkpA           PG----TEVIDATGKYVFPGFIDPHVH-------------------------------------------


                         +         .         .         .         .         *         .:210
query           GSWIPAQFAENRAPTVAELSHALPDHPAYIQYLYDYALVNQRGIDVLGLNDTPPPDLAGIGVERDAKGSA
3ggmB           ----------------------------------------------------------------------
3ggmA           ----------------------------------------------------------------------
3icjA           FGFGWDQDELGRWPTREDLD--VIDRPVFLRRCFHVAVMNSKMIDLLNLKPSKDFD-ESTGIVRERALEE
3etkA           FGFGWDQDELGRWPTREDLD--VIDRPVFLRRCFHVAVMNSKMIDLLNLKPSKDFD-ESTGIVRERALEE
1v4yA           ----------------------------------------------------------------------
1rjqA           ----------------------------------------------------------------------
1m7jA           ----------------------------------------------------------------------
3ighX           FGWDQDELGE--WPTRKELNAI--DKPVFIRKCFHVAVANDKMLELLNL--TPSKDFEDTGIIKEKSLEE
1gkrA           ----------------------------------------------------------------------
3h4uA           ----------------------------------------------------------------------
3e74C           ----------------------------------------------------------------------
3e74B           ----------------------------------------------------------------------
3feqO           ----------------------------------------------------------------------
3feqN           ----------------------------------------------------------------------
3feqL           ----------------------------------------------------------------------
3feqK           ----------------------------------------------------------------------
3feqJ           ----------------------------------------------------------------------
3feqC           ----------------------------------------------------------------------
3feqA           ----------------------------------------------------------------------
3e74A           ----------------------------------------------------------------------
2g3fA           ----------------------------------------------------------------------
2bb0A           ----------------------------------------------------------------------
1nfgA           ----------------------------------------------------------------------
2r8cF           ----------------------------------------------------------------------
2r8cD           ----------------------------------------------------------------------
2r8cB           ----------------------------------------------------------------------
2r8cA           ----------------------------------------------------------------------
1gkpA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TGKLFGDIAAFNQLFASISSNADREGGLRQFFADMNARGVTGIIDPSAGPAAAYEPLFAMRNQGDLPLRV
3ggmB           ----------------------------------------------------------------------
3ggmA           ----------------------------------------------------------------------
3icjA           SRKIINE---------KILTVKDYKHYIESAQEHLLSLGVHSVGFMSVGEKAL-KALFELEREGRLKMNV
3etkA           SRKIINE---------KILTVKDYKHYIESAQEHLLSLGVHSVGFMSVGEKAL-KALFELEREGRLKMNV
1v4yA           ----------------------------------------------------------------------
1rjqA           ----------------------------------------------------------------------
1m7jA           ----------------------------------------------------------------------
3ighX           ARKV------INERVLTVEDYVYYIKRAQEHLLDLGVKSVSFM----SVNEKALRALFYLEREGKLSINV
1gkrA           ----------------------------------------------------------------------
3h4uA           ----------------------------------------------------------------------
3e74C           ----------------------------------------------------------------------
3e74B           ----------------------------------------------------------------------
3feqO           ----------------------------------------------------------------------
3feqN           ----------------------------------------------------------------------
3feqL           ----------------------------------------------------------------------
3feqK           ----------------------------------------------------------------------
3feqJ           ----------------------------------------------------------------------
3feqC           ----------------------------------------------------------------------
3feqA           ----------------------------------------------------------------------
3e74A           ----------------------------------------------------------------------
2g3fA           ----------------------------------------------------------------------
2bb0A           ----------------------------------------------------------------------
1nfgA           ----------------------------------------------------------------------
2r8cF           ----------------------------------------------------------------------
2r8cD           ----------------------------------------------------------------------
2r8cB           ----------------------------------------------------------------------
2r8cA           ----------------------------------------------------------------------
1gkpA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GYRIPVQPEAKGHEAQWFSNLMAFRPARADDGQLAFLGLGESLVAGMNDGVRMAPGFSSSDQDKTALRQV
3ggmB           ----------------------------------------------------------------------
3ggmA           ----------------------------------------------------------------------
3icjA           FAYLSPELLDKLEEL----NLGKFEGRRLRIWGVLFVGSLGARTALLSEPYTDNPTTSGEVMNKDEIVEV
3etkA           FAYLSPELLDKLEEL----NLGKFRRLRIWGVKLFVDGSLGARTALLSEPYTDNPTTSGEVMNKDEIVEV
1v4yA           ----------------------------------------------------------------------
1rjqA           ----------------------------------------------------------------------
1m7jA           ----------------------------------------------------------------------
3ighX           AY---VTPEV-------LDKLESIGLGRFQGNRLTIAGV--KLFTDGSLGARTADDPSTSGQEREELIRI
1gkrA           ----------------------------------------------------------------------
3h4uA           ----------------------------------------------------------------------
3e74C           ----------------------------------------------------------------------
3e74B           ----------------------------------------------------------------------
3feqO           ----------------------------------------------------------------------
3feqN           ----------------------------------------------------------------------
3feqL           ----------------------------------------------------------------------
3feqK           ----------------------------------------------------------------------
3feqJ           ----------------------------------------------------------------------
3feqC           ----------------------------------------------------------------------
3feqA           ----------------------------------------------------------------------
3e74A           ----------------------------------------------------------------------
2g3fA           ----------------------------------------------------------------------
2bb0A           ----------------------------------------------------------------------
1nfgA           ----------------------------------------------------------------------
2r8cF           ----------------------------------------------------------------------
2r8cD           ----------------------------------------------------------------------
2r8cB           ----------------------------------------------------------------------
2r8cA           ----------------------------------------------------------------------
1gkpA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ATFAAKRGIPLEIHAYTDDSADAILTIFEQVAQQYDLRPLRWSIAHLNTGSPQTLERMRKLGLAYTVQMG
3ggmB           ----------------------------------------------------------------------
3ggmA           ----------------------------------------------------------------------
3icjA           IERAKPLGLDVAVHAIGDKAVDVALDAFEEAE-------FSGRIEHASLVRDDQLERIKELKVRISAQ--
3etkA           IERAKPLGLDVAVHAIGDKAVDVALDAFEEAE-------FSGRIEHASLVRDDQLERIKELKVRISAQ--
1v4yA           ----------------------------------------------------------------------
1rjqA           ----------------------------------------------------------------------
1m7jA           ----------------------------------------------------------------------
3ighX           TEKARSLGLDVAIHAIGDKALDVALDVFETTG-------FPGRIEHASLVRDDQLERVKNLKVRLSVQ--
1gkrA           ----------------------------------------------------------------------
3h4uA           ----------------------------------------------------------------------
3e74C           ----------------------------------------------------------------------
3e74B           ----------------------------------------------------------------------
3feqO           ----------------------------------------------------------------------
3feqN           ----------------------------------------------------------------------
3feqL           ----------------------------------------------------------------------
3feqK           ----------------------------------------------------------------------
3feqJ           ----------------------------------------------------------------------
3feqC           ----------------------------------------------------------------------
3feqA           ----------------------------------------------------------------------
3e74A           ----------------------------------------------------------------------
2g3fA           ----------------------------------------------------------------------
2bb0A           ----------------------------------------------------------------------
1nfgA           ----------------------------------------------------------------------
2r8cF           ----------------------------------------------------------------------
2r8cD           ----------------------------------------------------------------------
2r8cB           ----------------------------------------------------------------------
2r8cA           ----------------------------------------------------------------------
1gkpA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           PYFEGLAIRDANPPGATDNSPPVRLALDKGLVVAGGTDSTRIGIAGVWHAIEYHITGIASGGSVRKPASE
3ggmB           ----------------------------------------------------------------------
3ggmA           ----------------------------------------------------------------------
3icjA           PHFIVSDWWIVNRVGEERAKWAYRLKTLSSITKLGFSTDSPIEPADPWVSID------AAVNRYVVDPGE
3etkA           PHFIVSDWWIVNRVGEERAKWAYRLKTLSSITKLGFSTDSPIEPADPWVSID------AAVNRYVVDPGE
1v4yA           ----------------------------------------------------------------------
1rjqA           ----------------------------------------------------------------------
1m7jA           ----------------------------------------------------------------------
3ighX           PHF-------------------------------------------------------------------
1gkrA           ----------------------------------------------------------------------
3h4uA           ----------------------------------------------------------------------
3e74C           ----------------------------------------------------------------------
3e74B           ----------------------------------------------------------------------
3feqO           ----------------------------------------------------------------------
3feqN           ----------------------------------------------------------------------
3feqL           ----------------------------------------------------------------------
3feqK           ----------------------------------------------------------------------
3feqJ           ----------------------------------------------------------------------
3feqC           ----------------------------------------------------------------------
3feqA           ----------------------------------------------------------------------
3e74A           ----------------------------------------------------------------------
2g3fA           ----------------------------------------------------------------------
2bb0A           ----------------------------------------------------------------------
1nfgA           ----------------------------------------------------------------------
2r8cF           ----------------------------------------------------------------------
2r8cD           ----------------------------------------------------------------------
2r8cB           ----------------------------------------------------------------------
2r8cA           ----------------------------------------------------------------------
1gkpA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RLTRLEALALYTRHAAWLAFAEQHRGQLSVGKQADLAVLNQxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ggmB           ----------------------------------------------------------------------
3ggmA           ----------------------------------------------------------------------
3icjA           RVSREEALHLYTHGSAQVTLAED-LGKLERGFRAEYIILDR-----------------------------
3etkA           RVSREEALHLYTHGSAQVTLAED-LGKLERGFRAEYIILDR-----------------------------
1v4yA           ----------------------------------------------------------------------
1rjqA           ----------------------------------------------------------------------
1m7jA           ----------------------------------------------------------------------
3ighX           ----------------------------------------------------------------------
1gkrA           ----------------------------------------------------------------------
3h4uA           ----------------------------------------------------------------------
3e74C           ----------------------------------------------------------------------
3e74B           ----------------------------------------------------------------------
3feqO           ----------------------------------------------------------------------
3feqN           ----------------------------------------------------------------------
3feqL           ----------------------------------------------------------------------
3feqK           ----------------------------------------------------------------------
3feqJ           ----------------------------------------------------------------------
3feqC           ----------------------------------------------------------------------
3feqA           ----------------------------------------------------------------------
3e74A           ----------------------------------------------------------------------
2g3fA           ----------------------------------------------------------------------
2bb0A           ----------------------------------------------------------------------
1nfgA           ----------------------------------------------------------------------
2r8cF           ----------------------------------------------------------------------
2r8cD           ----------------------------------------------------------------------
2r8cB           ----------------------------------------------------------------------
2r8cA           ----------------------------------------------------------------------
1gkpA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxx
3ggmB           ------
3ggmA           ------
3icjA           ------
3etkA           ------
1v4yA           ------
1rjqA           ------
1m7jA           ------
3ighX           ------
1gkrA           ------
3h4uA           ------
3e74C           ------
3e74B           ------
3feqO           ------
3feqN           ------
3feqL           ------
3feqK           ------
3feqJ           ------
3feqC           ------
3feqA           ------
3e74A           ------
2g3fA           ------
2bb0A           ------
1nfgA           ------
2r8cF           ------
2r8cD           ------
2r8cB           ------
2r8cA           ------
1gkpA           ------