[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:nuoB

[Show Plain Result]

#ERROR : Can't open dsspfile "3i9v6.bssp"
#ERROR : Can't open dsspfile "2fug6.bssp"

## Summary of PDB Search
:220
    2e-28  46%  3i9v6  [x.x.x] NADH-QUINONE OXIDOREDUCTASE SUBUNIT 6
    1e-27  46%  2fug6  [x.x.x] NADH-QUINONE OXIDOREDUCTASE CHAIN 6
:220

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
3i9v6           ----------------------------------EGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMA
2fug6           ----------------------------------EGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMA


                         .         .         *         .         .         .         .:140
query           SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
3i9v6           STDA----------------RQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYA
2fug6           STDA-----------------QADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYA


                         +         .         .         .         .         *         .:210
query           VVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLQESIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3i9v6           IXXXXXXXXXXXXXXXXXXXRPEALIYAVMQLQKKV----------------------------------
2fug6           IXXXXXXXXXXXXXXXXXXXRPEALIYAVMQLQKKV----------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxx
3i9v6           ----------
2fug6           ----------