[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF67711.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2vb7A.bssp"
#ERROR : Can't open dsspfile "2buhA.bssp"
#ERROR : Can't open dsspfile "1h4fB.bssp"
#ERROR : Can't open dsspfile "1h4fA.bssp"
#ERROR : Can't open dsspfile "1dd8A.bssp"
#ERROR : Can't open dsspfile "2vb8C.bssp"
#ERROR : Can't open dsspfile "2vb8A.bssp"
#ERROR : Can't open dsspfile "2byzA.bssp"
#ERROR : Can't open dsspfile "2byyA.bssp"
#ERROR : Can't open dsspfile "2bywA.bssp"
#ERROR : Can't open dsspfile "1ek4A.bssp"
#ERROR : Can't open dsspfile "1oeqA.bssp"
#ERROR : Can't open dsspfile "2vb7C.bssp"
#ERROR : Can't open dsspfile "2bz4D.bssp"
#ERROR : Can't open dsspfile "1j3nA.bssp"
#ERROR : Can't open dsspfile "2gqdA.bssp"
#ERROR : Can't open dsspfile "1b3nA.bssp"
#ERROR : Can't open dsspfile "2gfyA.bssp"
#ERROR : Can't open dsspfile "2gfvA.bssp"
#ERROR : Can't open dsspfile "1oxhA.bssp"
#ERROR : Can't open dsspfile "1ox0A.bssp"
#ERROR : Can't open dsspfile "2almA.bssp"
#ERROR : Can't open dsspfile "2rjtA.bssp"
#ERROR : Can't open dsspfile "2ix4A.bssp"
#ERROR : Can't open dsspfile "3e60A.bssp"
#ERROR : Can't open dsspfile "2iwyA.bssp"
#ERROR : Can't open dsspfile "1e5mA.bssp"
#ERROR : Can't open dsspfile "2iwzA.bssp"
#ERROR : Can't open dsspfile "2iwyB.bssp"
#ERROR : Can't open dsspfile "2gp6A.bssp"
#ERROR : Can't open dsspfile "2c9hA.bssp"
#ERROR : Can't open dsspfile "2wgeA.bssp"
#ERROR : Can't open dsspfile "2wgfA.bssp"
#ERROR : Can't open dsspfile "1tqyA.bssp"
#ERROR : Can't open dsspfile "2vz9B.bssp"
#ERROR : Can't open dsspfile "2vz9A.bssp"
#ERROR : Can't open dsspfile "2vz8B.bssp"
#ERROR : Can't open dsspfile "2vz8A.bssp"
#ERROR : Can't open dsspfile "2qo3B.bssp"
#ERROR : Can't open dsspfile "2qo3A.bssp"
#ERROR : Can't open dsspfile "2hg4F.bssp"
#ERROR : Can't open dsspfile "2hg4E.bssp"
#ERROR : Can't open dsspfile "2hg4D.bssp"
#ERROR : Can't open dsspfile "2hg4A.bssp"
#ERROR : Can't open dsspfile "1tqyB.bssp"
#ERROR : Can't open dsspfile "2uv9F.bssp"
#ERROR : Can't open dsspfile "2uv9E.bssp"
#ERROR : Can't open dsspfile "2uv9D.bssp"
#ERROR : Can't open dsspfile "2uv9C.bssp"
#ERROR : Can't open dsspfile "2uv9B.bssp"
#ERROR : Can't open dsspfile "2uv9A.bssp"
#ERROR : Can't open dsspfile "2vkzA.bssp"
#ERROR : Can't open dsspfile "2uv8A.bssp"
#ERROR : Can't open dsspfile "2pffA.bssp"
#ERROR : Can't open dsspfile "3hmjA.bssp"

## Summary of PDB Search
:404
      0.0  95%  2vb7A  [c.95.1 - c.95.1 (1og9D)] 3-OXOACYL-[ACYL-CARRIER-PROTEIN]
      0.0  95%  2buhA  [c.95.1 - c.95.1 (1og8A)] 3-OXOACYL-[ACYL-CARRIER-PROTEIN]
      0.0  94%  1h4fB  [c.95.1 - c.95.1] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
      0.0  94%  1h4fA  [c.95.1 - c.95.1] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
      0.0  94%  1dd8A  [c.95.1 - c.95.1] BETA-KETOACYL [ACYL CARRIER PROTEIN]
      0.0  95%  2vb8C  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 1
      0.0  95%  2vb8A  [c.95.1 - c.95.1 (1fj4A)] 3-OXOACYL-[ACYL-CARRIER-PROTEIN]
      0.0  94%  2byzA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
      0.0  94%  2byyA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
      0.0  94%  2bywA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
      0.0  94%  1ek4A  [c.95.1 - c.95.1] BETA-KETOACYL [ACYL CARRIER PROTEIN]
      0.0  94%  1oeqA  [c.95.1 - c.95.1] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
      0.0  95%  2vb7C  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 1
      0.0  94%  2bz4D  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
    3e-57  37%  1j3nA  [c.95.1 - c.95.1] 3-OXOACYL-(ACYL-CARRIER PROTEIN) SYNTHASE
    3e-56  38%  2gqdA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 2
    2e-54  34%  1b3nA  [c.95.1 - c.95.1] PROTEIN (KETOACYL ACYL CARRIER PROTEIN
    1e-53  34%  2gfyA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 2
    6e-53  34%  2gfvA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 2
    5e-49  33%  1oxhA  [c.95.1 - c.95.1] BETA KETOACYL-ACYL CARRIER PROTEIN SYNTHASE
    5e-49  33%  1ox0A  [c.95.1 - c.95.1] BETA KETOACYL-ACYL CARRIER PROTEIN SYNTHASE
    7e-48  33%  2almA  [x.x.x] 3-OXOACYL-(ACYL-CARRIER-PROTEIN) SYNTHASE II
    1e-47  33%  2rjtA  [x.x.x] BETA-KETOACYL-ACP SYNTHASE II
    2e-47  34%  2ix4A  [c.95.1 - c.95.1 (1w0iA)] 3-OXOACYL-[ACYL-CARRIER-PROTEIN]
    1e-46  39%  3e60A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN ] SYNTHASE II
    4e-46  33%  2iwyA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE
    7e-46  34%  1e5mA  [c.95.1 - c.95.1] BETA KETOACYL ACYL CARRIER PROTEIN SYNTHASE
    3e-45  33%  2iwzA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE
    3e-45  33%  2iwyB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE
    3e-44  33%  2gp6A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 2
    7e-43  32%  2c9hA  [x.x.x] MITOCHONDRIAL BETA-KETOACYL SYNTHASE
    9e-41  33%  2wgeA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 1
    2e-39  33%  2wgfA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 1
    9e-33  31%  1tqyA  [c.95.1 - c.95.1] BETA-KETOACYL SYNTHASE/ACYL TRANSFERASE
    2e-14  36%  2vz9B  [x.x.x] FATTY ACID SYNTHASE
    2e-14  36%  2vz9A  [x.x.x] FATTY ACID SYNTHASE
    2e-14  36%  2vz8B  [x.x.x] FATTY ACID SYNTHASE
    2e-14  36%  2vz8A  [x.x.x] FATTY ACID SYNTHASE
    1e-12  25%  2qo3B  [x.x.x] ERYAII ERYTHROMYCIN POLYKETIDE SYNTHASE MODULES
    1e-12  25%  2qo3A  [x.x.x] ERYAII ERYTHROMYCIN POLYKETIDE SYNTHASE MODULES
    2e-07  25%  2hg4F  [x.x.x] 6-DEOXYERYTHRONOLIDE B SYNTHASE
    2e-07  25%  2hg4E  [x.x.x] 6-DEOXYERYTHRONOLIDE B SYNTHASE
    2e-07  25%  2hg4D  [x.x.x] 6-DEOXYERYTHRONOLIDE B SYNTHASE
    2e-07  25%  2hg4A  [x.x.x] 6-DEOXYERYTHRONOLIDE B SYNTHASE
    5e-06  21%  1tqyB  [c.95.1 - c.95.1] ACTINORHODIN POLYKETIDE PUTATIVE
    5e-05  23%  2uv9F  [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS
    5e-05  23%  2uv9E  [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS
    5e-05  23%  2uv9D  [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS
    5e-05  23%  2uv9C  [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS
    5e-05  23%  2uv9B  [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS
    5e-05  23%  2uv9A  [x.x.x] FATTY ACID SYNTHASE ALPHA SUBUNITS
    6e-05  35%  2vkzA  [x.x.x] FATTY ACID SYNTHASE SUBUNIT ALPHA
    6e-05  35%  2uv8A  [x.x.x] FATTY ACID SYNTHASE SUBUNIT ALPHA (FAS2)
    6e-05  35%  2pffA  [x.x.x] FATTY ACID SYNTHASE SUBUNIT ALPHA
    6e-05  35%  3hmjA  [x.x.x] FATTY ACID SYNTHASE SUBUNIT ALPHA
:404

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLIDRKVVRFMSD
2vb7A           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
2buhA           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
1h4fB           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
1h4fA           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
1dd8A           MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
2vb8C           -KRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
2vb8A           -KRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
2byzA           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
2byyA           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
2bywA           MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
1ek4A           MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
1oeqA           MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
2vb7C           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
2bz4D           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
1j3nA           MRRVVVTGLGALTPIGVGQEAFHKAQLAGKSGVRPITRFDASALPVRIAAEVDVDPGAYLDRKELRRLDR
2gqdA           -KRVVITGMGALSPIGNDVKTTWENALKGVNGIDKITRIDTEPYSVHLAGELKFNIEDHIDKKEARRMDR
1b3nA           -RRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKFNCEDIISRKEQRKMDA
2gfyA           -RRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKFNCEDIISRKEQRKMDA
2gfvA           -RRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKFNCEDIISRKEQRKMDA
1oxhA           LNRVVVTGYGVTSPIGNTPEEFWNSLAXXXXXXXXXXXFDHSDFDVHNAAEIQFPFDKYFVKKDTNRFDN
1ox0A           LNRVVVTGYGVTSPIGNTPEEFWNSLAXXXXXXXXXXXFDHSDFDVHNAAEIQFPFDKYFVKKDTNRFDN
2almA           LNRVVVTGYGVTSPIGNTPEEFWNSLAXXXXXXXXXXXFDHSDFDVHNAAEIQFPFDKYFVKKDTNRFDN
2rjtA           LNRVVVTGYGVTSPIGNTPAEFWNSLAXXXXXXXXXXXFDHSDFDVHNAAEIQFPFDKYFVKKDTNRFDN
2ix4A           -RRVVVTGLGMVTPLGRGVETTWRRLIDGECGIR-GLTLDDLKMKS-FDEETKLYTFDQLSSKVAAFVPY
3e60A           ----------------------------------------------------------------------
2iwyA           -RRVVITGIGLVTPLGVGTHLVWDRLIGGESGIVVGEEYKSIPCSVAAYDEGQFNEQNFVSKSDIKSMSS
1e5mA           -KRVVVTGLGAITPIGNTLQDYWQGLMEGRNGIGPITRFDASDQACRFGGEVKFDATQFLDRKEAKRMDR
2iwzA           -RRVVITGIGLVTPLGVGTHLVWDRLIGGESGIVVGEEYKSIPCSVAAYDEGQFNEQNFVSKSDIKSMSS
2iwyB           -RRVVITGIGLVTPLGVGTHLVWDRLIGGESGIVVGEEYKSIPCSVAAYDEGQFNEQNFVSKSDIKSMSS
2gp6A           ----VVTGIAMTTALATDAETTWKLLLDRQSGIRTLDDVEEFDLPVRIGGHLLEEFDHQLTRIELRRMGY
2c9hA           -RRVVITGIGLVTPLGVGTHLVWDRLIGGESGIVVGEEYKSIPCSVAAYDEGQFNEQNFVSKSDIKSMSS
2wgeA           -------------SISPDIESTWKGLLAGESGIHALEDVTKWDLAVKIGGHLKDPVDSHMGRLDMRRMSY
2wgfA           -------------SISPDIESTWKGLLAGESGIHALEDVTKWDLAVKIGGHLKDPVDSHMGRLDMRRMSY
1tqyA           -RRVVITGVGVRAPGGNGTRQFWELLTSGRTATRRISFFDPSPYRSQVAAEADFDPVGFGPRELDR-MDR
2vz9B           ----------------------------------------------------------------------
2vz9A           ----------------------------------------------------------------------
2vz8B           ----------------------------------------------------------------------
2vz8A           ----------------------------------------------------------------------
2qo3B           ----------------------------------------------------------------------
2qo3A           ----------------------------------------------------------------------
2hg4F           ----------------------------------------------------------------------
2hg4E           ----------------------------------------------------------------------
2hg4D           ----------------------------------------------------------------------
2hg4A           ----------------------------------------------------------------------
1tqyB           ----LITGVGVVAPNGLGLAPYWSAVLDGRHGLGPVTRFDVSRYPATLAGQIDFHAPDHIPGRLLPQTDP
2uv9F           -----------------------------------------------------------VPEDIIQQVDP
2uv9E           -----------------------------------------------------------VPEDIIQQVDP
2uv9D           -----------------------------------------------------------VPEDIIQQVDP
2uv9C           -----------------------------------------------------------VPEDIIQQVDP
2uv9B           -----------------------------------------------------------VPEDIIQQVDP
2uv9A           -----------------------------------------------------------VPEDIIQQVDP
2vkzA           ----------------------------------------------------------------------
2uv8A           ----------------------------------------------------------------------
2pffA           ----------------------------------------------------------------------
3hmjA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAMRSPRGLKAVGPYVVTKAMAS
2vb7A           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
2buhA           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
1h4fB           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
1h4fA           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
1dd8A           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
2vb8C           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
2vb8A           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
2byzA           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
2byyA           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
2bywA           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
1ek4A           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
1oeqA           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
2vb7C           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
2bz4D           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
1j3nA           FVQYALIAAQLALEDAGLKPEDLDPE-RVGTLVGTGGGMETWEAQSRVFLE--RGPNRISPFFIPMMIAN
2gqdA           FTQYAIVAAREAVKDAQL--DINENTARIGVWIGSGGGMETFEIAHKQLM--DKGPRRVSPFFVPMLIPD
1b3nA           FIQYGIVAGVQAMQDSGL--EITEENATRXXXXXXXXXXXXXXXEENHTSLMNGGPRKISPFFVPSTIVN
2gfyA           FIQYGIVAGVQAMQDSGL--EITEENATRXXXXXXXXXXXXXXXEENHTSLMNGGPRKISPFFVPSTIVN
2gfvA           FIQYGIVAGVQAMQDSGL--EITEENATRXXXXXXXXXXXXXXXEENHTSLMNGGPRKISPFFVPSTIVN
1oxhA           YSLYALYAAQEAVNHANLDVEAL-NRDRFGVIVASGIGGIK-EIEDQVLRLHEKGPKRVKPMTLPKALPN
1ox0A           YSLYALYAAQEAVNHANLDVEAL-NRDRFGVIVASGIGGIK-EIEDQVLRLHEKGPKRVKPMTLPKALPN
2almA           YSLYALYAAQEAVNHANLDVEAL-NRDRFGVIVASGIGGIK-EIEDQVLRLHEKGPKRVKPMTLPKALPN
2rjtA           YSLYALYAAQEAVNHANLDVAAL-NRDRFGVIVASGIGGIK-EIEDQVLRLHEKGPKRVKPMTLPKALPN
2ix4A           GSNYAVCAADEALRDAEWLPTEEEEKERTXXXXXXXXXXXCDIVEAAQLICEKR-LRRLSPFFIPKILVN
3e60A           -----------------------------------------------------KGPRRISPFFIPGRLIN
2iwyA           PTIMAIGAAELAMKDSGWHPQSEADQVATGVAIGMG--MIPLEVVSETALNQTKGYNKVSPFFVPKILVN
1e5mA           FCHFAVCASQQAINDAKLV--INELNADEXXXXXXXXXXXXXXXEDQQTILLDKGPSRCSPFMIPMMIAN
2iwzA           PTIMAIGAAELAMKDSGWHPQSEADQVATGVAIGMG--MIPLEVVSETALNQTKGYNKVSPFFVPKILVN
2iwyB           PTIMAIGAAELAMKDSGWHPQSEADQVATGVAIGMG--MIPLEVVSETALNQTKGYNKVSPFFVPKILVN
2gp6A           LQRMSTVLSRRLWENAG-SPEVDTNRLMVSI--GTGLGSAEELVFSYDDMRA-RGMKAVSPLTVQKYMPN
2c9hA           PTIMAIGAAELAMKDSGWHPQSEADQVATGVAIGMG--MIPLEVVSETALNQTKGYNKVSPFFVPKILVN
2wgeA           VQRMGKLLGGQLWESAG-SPEV--DPDRFAVVVGTGLGGAERIVESYDLMNAG-GPRKVSPLAVQMIMPN
2wgfA           VQRMGKLLGGQLWESAG-SPEV--DPDRFAVVVGTGLGGAERIVESYDLMNAG-GPRKVSPLAVQMIMPN
1tqyA           ASQFXXXXXXXXXXXSGLDPDTLDXXEREYLLLSDSGRD-----WEVDAAWLSRHMF---DYLVPSVMPA
2vz9B           ----------------------------------------------------------------------
2vz9A           ----------------------------------------------------------------------
2vz8B           ----------------------------------------------------------------------
2vz8A           ----------------------------------------------------------------------
2qo3B           -------------------------------------------------------------YSVTGVAPA
2qo3A           -------------------------------------------------------------YSVTGVAPA
2hg4F           -------------------------------------------------------------YVGTGTASS
2hg4E           -------------------------------------------------------------YVGTGTASS
2hg4D           -------------------------------------------------------------YVGTGTASS
2hg4A           -------------------------------------------------------------YVGTGTASS
1tqyB           STRLALTAADWALQDAKADPESLTDYD-MGVVTANACGGFDFREFRKLWSEGPKSVSVYESFAWFYAVNT
2uv9F           VTLYVLVSVAEALLSSGITDPYYVHLSEVGNCIGSGGGTSALRGMYKDRYLDKPVQKDILQESFVNTMAA
2uv9E           VTLYVLVSVAEALLSSGITDPYYVHLSEVGNCIGSGGGTSALRGMYKDRYLDKPVQKDILQESFVNTMAA
2uv9D           VTLYVLVSVAEALLSSGITDPYYVHLSEVGNCIGSGGGTSALRGMYKDRYLDKPVQKDILQESFVNTMAA
2uv9C           VTLYVLVSVAEALLSSGITDPYYVHLSEVGNCIGSGGGTSALRGMYKDRYLDKPVQKDILQESFVNTMAA
2uv9B           VTLYVLVSVAEALLSSGITDPYYVHLSEVGNCIGSGGGTSALRGMYKDRYLDKPVQKDILQESFVNTMAA
2uv9A           VTLYVLVSVAEALLSSGITDPYYVHLSEVGNCIGSGGGTSALRGMYKDRYLDKPVQKDILQESFVNTMAA
2vkzA           ----------------------------------------------------------------------
2uv8A           ----------------------------------------------------------------------
2pffA           ----------------------------------------------------------------------
3hmjA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
2vb7A           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
2buhA           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
1h4fB           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
1h4fA           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
1dd8A           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
2vb8C           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
2vb8A           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
2byzA           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
2byyA           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
2bywA           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
1ek4A           GVSACLATPFKIHGVNYSISSASATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
1oeqA           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
2vb7C           GVSACLATPFKIHGVNYSISSA-ATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
2bz4D           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
1j3nA           MASAHIAMRYGFTGPSSTVVTACATGADALGSALRMIQLGEADLVLAGGTEAAITPMAIAFAVMRALSTR
2gqdA           MATGQVSIDLGAKGPNGATVTACATGTNSIGEAFKIVQRGDADAMITGGTEAPITHMAIAFSASRALST-
1b3nA           MVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGFGAARALSTR
2gfyA           MVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGFGAARALSTR
2gfvA           MVAGHLTIMYGLRGPSISIATAQTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGFGAARALSTR
1oxhA           MASGNVAMRFGANGVCKSINTACSSSNDAIGDAFRSIKFGFQDVMLVGGTEASITPFAAGFQALTALST-
1ox0A           MASGNVAMRFGANGVCKSINTACSSSNDAIGDAFRSIKFGFQDVMLVGGTEASITPFAAGFQALTALST-
2almA           MASGNVAMRFGANGVCKSINTACSSSNDAIGDAFRSIKFGFQDVMLVGGTEASITPFAAGFQALTALST-
2rjtA           MASGNVAMRFGANGVCKSINTACSSSNDAIGDAFRSIKFGFQDVMLVGGTEASITPFAAGFQALTALST-
2ix4A           MASGHVSMKYGFQGPNHAAVTACATGAHSIGDATRMIQFGDADVMVAGGTESSIDALSVAFSRSRALSTK
3e60A           LASGYVSIKYGLRGPNHSVVTACSTGAHAIGDAARLIALGDADVMLAGGTESPINRISLAFSACRALSTC
2iwyA           MAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSAGFSRARALST-
1e5mA           MASGLTAINLGAKGPNNCTVTACAAGSNAIGDAFRLVQNGYAKAMICGGTEAAITPLSAGFASARALSFR
2iwzA           MAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSAGFSRARALST-
2iwyB           MAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSAGFSRARALST-
2gp6A           GAAAAVGLERHAKAGVMTPVSACASGAEAIARAWQQIVLGEADAAICGGVETRIEAVPIAFAQMRIVMST
2c9hA           MAAGQVSIRYKLKGPNHAVSTA-TTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAFSRARALST-
2wgeA           GAAAVIGLQLGARAGVMTPVSACSSGSEAIAHAWRQIVMGDADVAVCGGVEGPIEALPAAFSMMRAMSTR
2wgfA           GAAAVIGLQLGARAGVMTPVSAQSSGSEAIAHAWRQIVMGDADVAVCGGVEGPIEALPAAFSMMRAMSTR
1tqyA           EVAWAVGAE----GPVTMVSTGCTSGLDSVGNAVRAIEEGSADVMFAGAADTPITPIAC-FDAIRA-TTA
2vz9B           ----------------------------------------------------------------------
2vz9A           ----------------------------------------------------------------------
2vz8B           ----------------------------------------------------------------------
2vz8A           ----------------------------------------------------------------------
2qo3B           VASGRISYTMGLEGPSISVDTACSSSLVALHLAVESLRKGESSXXXXXXXXXXXTPVFVDFSRQRALAA-
2qo3A           VASGRISYTMGLEGPSISVDTACSSSLVALHLAVESLRKGESSXXXXXXXXXXXTPVFVDFSRQRALAA-
2hg4F           VASGRVAYCLGLEGPA-TVDTACSSGLTAL-HLAESLRRDECGLALAGGVTVSSPGAFTEFRSQGGLAAD
2hg4E           VASGRVAYCLGLEGPA-TVDTACSSGLTAL-HLAESLRRDECGLALAGGVTVSSPGAFTEFRSQGGLAAD
2hg4D           VASGRVAYCLGLEGPA-TVDTACSSGLTAL-HLAESLRRDECGLALAGGVTVSSPGAFTEFRSQGGLAAD
2hg4A           VASGRVAYCLGLEGPA-TVDTACSSGLTAL-HLAESLRRDECGLALAGGVTVSSPGAFTEFRSQGGLAAD
1tqyB           GQ---ISIRHGMRGPSSALVAEQAGGLDALGHARRTIRRGTPLVVSGGVDSALDWGWVSQI-ASGRISTA
2uv9F           WVNMLLLSST---GPIKTPVGACATAVESLDVGYDTIMQGKARVCLVGGFDDFQEEGSYEFANMGATSNA
2uv9E           WVNMLLLSST---GPIKTPVGACATAVESLDVGYDTIMQGKARVCLVGGFDDFQEEGSYEFANMGATSNA
2uv9D           WVNMLLLSST---GPIKTPVGACATAVESLDVGYDTIMQGKARVCLVGGFDDFQEEGSYEFANMGATSNA
2uv9C           WVNMLLLSST---GPIKTPVGACATAVESLDVGYDTIMQGKARVCLVGGFDDFQEEGSYEFANMGATSNA
2uv9B           WVNMLLLSST---GPIKTPVGACATAVESLDVGYDTIMQGKARVCLVGGFDDFQEEGSYEFANMGATSNA
2uv9A           WVNMLLLSST---GPIKTPVGACATAVESLDVGYDTIMQGKARVCLVGGFDDFQEEGSYEFANMGATSNA
2vkzA           ---------------------ACATSVESVDIGVETILSGKARICIVGGYDDFQEEGSFEFGNMKATSNE
2uv8A           ---------------------ACATSVESVDIGVETILSGKARICIVGGYDDFQEEGSFEFGNMKATSNE
2pffA           ---------------------ACATSVESVDIGVETILSGKARICIVGGYDDFQEEGSFEFGNMKATSNE
3hmjA           ---------------------ACATSVESVDIGVETILSGKARICIVGGYDDFQEEGSFEFGNMKATSNE


                         .         .         .         +         .         .         .:280
query           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
2vb7A           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
2buhA           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
1h4fB           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
1h4fA           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
1dd8A           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
2vb8C           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
2vb8A           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
2byzA           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
2byyA           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
2bywA           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
1ek4A           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
1oeqA           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
2vb7C           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
2bz4D           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADM---SGEGAVRC
1j3nA           -NEEPEKASRPFTLSRDGFVMGEGAGVLVLEAYEHAKKRGARIYAELVGFGRSADAHHITEPHPEXXXXX
2gqdA           -NDDIETACRPFQEGRDGFVMGEGAGILVIESLESAQARGANIYAEIVGYGTTGDAYHITAPAGEGGSRA
1b3nA           -NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPEXXXXXX
2gfyA           -NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPEXXXXXX
2gfvA           -NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPEXXXXXX
1oxhA           -TEDPTRASIPFDKDRNGFVMGEGSGMLVLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPEGQGAIKA
1ox0A           -TEDPTRASIPFDKDRNGFVMGEGSGMLVLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPEGQGAIKA
2almA           -TEDPTRASIPFDKDRNGFVMGEGSGMLVLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPEGQGAIKA
2rjtA           -TEDPTRASIPFDKDRNGFVMGEGSGMLVLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPEGQGAIKA
2ix4A           FNSSPQEASRPFDCDRDGFVIGEGSGVIVLEEYEHAKRRGAKIYAELCGYGMSGDAHHITQPDGKGAVLA
3e60A           RNDDPERASRPYDVDRDGFVMGEGAAIVVLEELEHAKKRGARIYAEIIGYGLSGDAYHITAPSGEGAQRS
2iwyA           -NSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGD-AGHIDPEGEGALRC
1e5mA           -NDDPLHASRPFDKDRDGFVMGXXXXXXXXXXXXXXXXRGAKIYGEMVGYAMTCDAYHITAPDGRGATRA
2iwzA           -NSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPEGEGALRC
2iwyB           -NSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPEGEGALRC
2gp6A           NNDDPAGACRPFDRDRDGFVFGEGGALLLIETEEHAKARGANILARIMGASITSDGFHMVAPAGHAITRA
2c9hA           -NSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPEGEGALRC
2wgeA           -NDEPERASRPFDKDRDGFVFGEAGALMLIETEEHAKARGAKPLARLLGAGITSDAFHMVAPAADGAGRA
2wgfA           -NDEPERASRPFDKDRDGFVFGEAGALMLIETEEHAKARGAKPLARLLGAGITSDAFHMVAPAADGAGRA
1tqyA           RNDDPEHASRPFDGTRDGFVLAEGAAMFVLEDYDSALARGARIHAEISGYATRCNAYHMTGLKADGTIRV
2vz9B           -----------------------------------SLAR--RVYATILNAGTNTDGSKVTFPSGEQLIRS
2vz9A           -----------------------------------SLAR--RVYATILNAGTNTDGSKVTFPSGEQLIRS
2vz8B           -----------------------------------SLAR--RVYATILNAGTNTDGSKVTFPSGEQLIRS
2vz8A           -----------------------------------SLAR--RVYATILNAGTNTDGSKVTFPSGEQLIRS
2qo3B           -----DGRSKXXXXXXXXXXXSEGVTLVLLERLSEARRNGHEVLAVVRGSALNQDGASLSAPSGPAQRRV
2qo3A           -----DGRSKXXXXXXXXXXXSEGVTLVLLERLSEARRNGHEVLAVVRGSALNQDGASLSAPSGPAQRRV
2hg4F           GRCKP------FSKAADGFGLAEGAGVLVLQRLSAARREGRPVLAVLRGSAVNQDGASLTAPSGPAQQRV
2hg4E           GRCKP------FSKAADGFGLAEGAGVLVLQRLSAARREGRPVLAVLRGSAVNQDGASLTAPSGPAQQRV
2hg4D           GRCKP------FSKAADGFGLAEGAGVLVLQRLSAARREGRPVLAVLRGSAVNQDGASLTAPSGPAQQRV
2hg4A           GRCKP------FSKAADGFGLAEGAGVLVLQRLSAARREGRPVLAVLRGSAVNQDGASLTAPSGPAQQRV
1tqyB           TD--PDRAYLPFDERAAGYVPGEGGAILVLEDSAAAEARGRHAYGELAGCASTFDPAP---GSGRGLERA
2uv9F           KEEEPGEMSRPTSTTRNGFMESQGCGVQVIMTAQLALEMGVPIYGIVAMTSTATDGRSVPAP-GQGVL--
2uv9E           KEEEPGEMSRPTSTTRNGFMESQGCGVQVIMTAQLALEMGVPIYGIVAMTSTATDGRSVPAP-GQGVL--
2uv9D           KEEEPGEMSRPTSTTRNGFMESQGCGVQVIMTAQLALEMGVPIYGIVAMTSTATDGRSVPAP-GQGVL--
2uv9C           KEEEPGEMSRPTSTTRNGFMESQGCGVQVIMTAQLALEMGVPIYGIVAMTSTATDGRSVPAP-GQGVL--
2uv9B           KEEEPGEMSRPTSTTRNGFMESQGCGVQVIMTAQLALEMGVPIYGIVAMTSTATDGRSVPAP-GQGVL--
2uv9A           KEEEPGEMSRPTSTTRNGFMESQGCGVQVIMTAQLALEMGVPIYGIVAMTSTATDGRSVPAP-GQGVL--
2vkzA           HGRTPAEMSRPATTTRNGFMEAQGAGIQIIMQADLALKMGVPIYG-IVAMAATATGRSVPAP-GKG----
2uv8A           HGRTPAEMSRPATTTRNGFMEAQGAGIQIIMQADLALKMGVPIYG-IVAMAATATGRSVPAP-GKG----
2pffA           HGRTPAEMSRPATTTRNGFMEAQGAGIQIIMQADLALKMGVPIYG-IVAMAATATGRSVPAP-GKG----
3hmjA           HGRTPAEMSRPATTTRNGFMEAQGAGIQIIMQADLALKMGVPIYG-IVAMAATATGRSVPAP-GKG----


                         .         *         .         .         .         .         +:350
query           MQMAMHGVDTPIDYLNSHGTSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLML
2vb7A           MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
2buhA           MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
1h4fB           MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATRAMTGHSLGAAGVQEAIYSLLML
1h4fA           MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATRAMTGHSLGAAGVQEAIYSLLML
1dd8A           MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
2vb8C           MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
2vb8A           MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
2byzA           MKMAMHGVDTPIDYLNSQGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
2byyA           MKMAMHGVDTPIDYLNSEGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
2bywA           MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATAAMTGHSLGAAGVQEAIYSLLML
1ek4A           MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
1oeqA           MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATAAMTGHSLGAKGVQEAIYSLLML
2vb7C           MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
2bz4D           MKMAMHGVDTPIDYLNSQGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
1j3nA           XXXXXXXAPEQVGYINAHGTSTPVGDRAEVLAIKRVFGDHAKMVSSTKSMIGHLLGAAGAVEAIATVQAL
2gqdA           MQAAMDGIEKDVQYLNAHGTSTPVGDLNEVKAIKNTFGEAAKKVSSTKSMTGHLLGATGGIEAIFSALSI
1b3nA           XXXXXXXRDAGIEYVNAHGTSTPAGDKAEAQAVKTIFGESRVLVSSTKSMTGHLLGAAGAVESIYSILAL
2gfyA           XXXXXXXRDAGIEYVNAHGTSTPAGDKAEAQAVKTIFGESRVLVSSTASMTGHLLGAAGAVESIYSILAL
2gfvA           XXXXXXXRDAGIEYVNAHGTSTPAGDKAEAQAVKTIFGESRVLVSSTKSMTGHLLGAAGAVESIYSILAL
1oxhA           IKLALEEAEEQVAYVNAHGTSTPANEKGESGAIVAVLGKEVP-VSSTKSFTGHLLGAAGAVEAIVTIEAM
1ox0A           IKLALEEAEEQVAYVNAHGTSTPANEKGESGAIVAVLGKEVP-VSSTKSFTGHLLGAAGAVEAIVTIEAM
2almA           IKLALEEAEEQVAYVNAAGTSTPANEKGESGAIVAVLGKEVP-VSSTKSFTGHLLGAAGAVEAIVTIEAM
2rjtA           IKLALEEAEEQVAYVNAHGTSTPANEKGESGAIVAVLGKAVP-VSSTKSFTGHLLGAAGAVEAIVTIEAM
2ix4A           MTRALRQCPNQIDYVNAHATSTPIGDAVEARAIKTVFSEHATAFSSTKXXXXXXXXXXXXVEAIFSILAI
3e60A           MMAALKRAQSELDYINAHGTST-MADVIELAAVERVLGYYAPSMSSTKSSIGHXXXXXXXXXXIFCVLAI
2iwyA           MAAALKGVQEEISYINAHATSTPLGDAAENKAIKHLFKDHALAVSSTKXXXXXXXXXXXXVEAAFTTLAC
1e5mA           IAWALKDSGLKVSYINAHGTSTPANDVTETRAIKQALGNHAYAVSSTKSMTGHLLGGSGGIEAVATVMAI
2iwzA           MAAALKGVQEEISYINAHATSTPLGDAAENKAIKHLFKDHALAVSSTKXXXXXXXXXXXXVEAAFTTLAC
2iwyB           MAAALKGVQEEISYINAHATSTPLGDAAENKAIKHLFKDHALAVSSTKXXXXXXXXXXXXVEAAFTTLAC
2gp6A           IQLAGLAPGD-IDHVNAHATGTQVGDLAEGRAINNALGGNRPAVYAPKSALGHSVGAVGAVESILTVLAL
2c9hA           MAAALKGVQEEISYINAHATSTPLGDAAENKAIKHLFKDHALAVSSTKXXXXXXXXXXXXVEAAFTTLAC
2wgeA           MSLELAGLSADIDHVNAHGTATPIGDAAEANAIR-VAGCDQAAVYAPKSALGHSIGAVGALESVLTVLTL
2wgfA           MSLELAGLSADIDHVNAHGTATPIGDAAEANAIR-VAGCDQAAVYAPKSALGHSIGAVGALESVLTVLTL
1tqyA           ALDESRTDATDIDYINAHGSGTRQNDRHETAAYKRALGEHATPVSSIKSMVGHSLGAIGSLEIAACVLAL
2vz9B           LYAPAGPDPESLEYIEAHGTGTKVGDPQELNGIVNALCATRREIGSTKSNMGHPEPASGVAALIKVLLSL
2vz9A           LYAPAGPDPESLEYIEAHGTGTKVGDPQELNGIVNALCATRREIGSTKSNMGHPEPASGVAALIKVLLSL
2vz8B           LYAPAGPDPESLEYIEAHGTGTKVGDPQELNGIVNALCATRREIGSTKSNMGHPEPASGVAALIKVLLSL
2vz8A           LYAPAGPDPESLEYIEAHGTGTKVGDPQELNGIVNALCATRREIGSTKSNMGHPEPASGVAALIKVLLSL
2qo3B           IRQALESCGLEVDAVEAHGTGTALGDPIEANALLDTYGRDRDALGSVKSNIGHTQAAAGVTGLLKVVLAL
2qo3A           IRQALESCGLEVDAVEAHGTGTALGDPIEANALLDTYGRDRDALGSVKSNIGHTQAAAGVTGLLKVVLAL
2hg4F           IRRALENAGVDVDYVEAHGTGTRLGDPIEVHALLSTYGDDPLWIGSVKSNIGHT----------------
2hg4E           IRRALENAGVDVDYVEAHGTGTRLGDPIEVHALLSTYGDDPLWIGSVKSNIGHT----------------
2hg4D           IRRALENAGVDVDYVEAHGTGTRLGDPIEVHALLSTYGDDPLWIGSVKSNIGHT----------------
2hg4A           IRRALENAGVDVDYVEAHGTGTRLGDPIEVHALLSTYGDDPLWIGSVKSNIGHT----------------
1tqyB           IRLALNDAGTGPEXXXXXXXXXPELDAAEARAIGRVFGREGXXXXXXXXXXGRLYSGGGPLDVVTALMSL
2uv9F           ----------------------------------------------------------------------
2uv9E           ----------------------------------------------------------------------
2uv9D           ----------------------------------------------------------------------
2uv9C           ----------------------------------------------------------------------
2uv9B           ----------------------------------------------------------------------
2uv9A           ----------------------------------------------------------------------
2vkzA           -----------------HGTSTKANDKNESATINEMMSEGNPVIGVQKFLTGHPKGAAGAWMMNGALQIL
2uv8A           -----------------HGTSTKANDKNESATINEMMSEGNPVIGVQKFLTGHPKGAAGAWMMNGALQIL
2pffA           -----------------HGTSTKANDKNESATINEMMSEGNPVIGVQKFLTGHPKGAAGAWMMNGALQIL
3hmjA           -----------------HGTSTKANDKNESATINEMMSEGNPVIGVQKFLTGHPKGAAGAWMMNGALQIL


                         .         .         .         .         *         .         .:420
query           EHGFIAPSINIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL
2vb7A           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL
2buhA           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL
1h4fB           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL
1h4fA           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL
1dd8A           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL
2vb8C           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL
2vb8A           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL
2byzA           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL
2byyA           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL
2bywA           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL
1ek4A           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL
1oeqA           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL
2vb7C           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL
2bz4D           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKL
1j3nA           YHGVIPPTIN-XXXXXXXXXXXXXXXXREAKVDYALSNSFAFGGHNAVLAFKRV
2gqdA           KDSKVAPTIHAVTPDPECDLDIVPNEAQDLDITYAMSNSLGFGGHNAVLVFKK-
1b3nA           RDQAVPPTINLDNPDE-GCDLDFVEARQVSGMEYTLCNSFGFGGTNGSLIFKKI
2gfyA           RDQAVPPTINLDNPDE-GCDLDFVEARQVSGMEYTLCNSFGFGGTNGSLIFKKI
2gfvA           RDQAVPPTINLDNPDE-GCDLDFVEARQVSGMEYTLCNSFGFGGTNGSLIFKKI
1oxhA           RHNFVPMTAGTSEVSDYIEANVVYGQGLEKEIPYAISNTFGFGGHNAVLAFKR-
1ox0A           RHNFVPMTAGTSEVSDYIEANVVYGQGLEKEIPYAISNTFGFGGHNAVLAFKR-
2almA           RHNFVPMTAGTSEVSDYIEANVVYAQGLEKEIPYAISNTFGFGGHNAVLAFKR-
2rjtA           RHNFVPMTAGTSEVSDYIEANVVYGQGLAKEIPYAISNTFGFGGHNAVLAFKR-
2ix4A           HHGVAPMTLNVKNFDKRFMPLT---TSKKMLVRTAMSNSFGFGGTNASLLFASI
3e60A           RDNIAPATLNLENPSIETKIDLVPHKPRERKIDTVLSNSFGFGGTNASLVMRR-
2iwyA           YYQKLPPTLNL-DCSEPEFDLNYVPLKAQEWKRFILTNSFGFGGTNATLCIAGL
1e5mA           AEDKVPPTINLENPDPECDLDYVPGQSRALIVDVALSNSFGFGGHNVTLAFKK-
2iwzA           YYQKLPPTLNL-DCSEPEFDLNYVPLKAQEWKTEKLTNSFGFGGTNATLCIAGL
2iwyB           YYQKLPPTLNL-DCSEPEFDLNYVPLKAQEWKTEKLTNSFGFGGTNATLCIAGL
2gp6A           RDQVIPPTLNLVNLDPEIDLDVVAGEPRPGNYRYAINNSFGFGGHNVAI-----
2c9hA           YYQKLPPTLNL-DCSEPEFDLNYVPLKAQEWKTEKLTNSFGFGGTNATLCIAGL
2wgeA           RDGVIPPTLNYETPDPEIDLDVVAGEPRYGDYRYAVNNSFGFGGHNVAL-----
2wgfA           RDGVIPPTLNYETPDPEIDLDVVAGEPRYGDYRYAVNNSFGFGGHNVAL-----
1tqyA           EHGVVPPTANLRTSDPECDLDYVPLEARERKLRSVLTVGSGFGGFQSAMVLR--
2vz9B           EHGVWAPNLNPEIPALQDGRLQVVDRPLPIRGGNVGINSFGFGGSNVHVILQ--
2vz9A           EHGVWAPNLNPEIPALQDGRLQVVDRPLPIRGGNVGINSFGFGGSNVHVILQ--
2vz8B           EHGVWAPNLNPEIPALQDGRLQVVDRPLPIRGGNVGINSFGFGGSNVHVILQ--
2vz8A           EHGVWAPNLNPEIPALQDGRLQVVDRPLPIRGGNVGINSFGFGGSNVHVILQ--
2qo3B           RNGELPATLHVEEVDWSSGGVALLPWRRGERTRRAAVSAFGISGTNAHVIVEE-
2qo3A           RNGELPATLHVEEVDWSSGGVALLPWRRGERTRRAAVSAFGISGTNAHVIVEE-
2hg4F           ------------------------------------------------------
2hg4E           ------------------------------------------------------
2hg4D           ------------------------------------------------------
2hg4A           ------------------------------------------------------
1tqyB           REGVIAPTAGVTSVPRE-YGIDLV------------------------------
2uv9F           ------------------------------------------------------
2uv9E           ------------------------------------------------------
2uv9D           ------------------------------------------------------
2uv9C           ------------------------------------------------------
2uv9B           ------------------------------------------------------
2uv9A           ------------------------------------------------------
2vkzA           NSGIIPGNRNADNVDK--------------------------------------
2uv8A           NSGIIPGNRNADNVDK--------------------------------------
2pffA           NSGIIPGNRNADNVDK--------------------------------------
3hmjA           NSGIIPGNRNADNVDK--------------------------------------