[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:artP

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "1ii8B.bssp"
#ERROR : Can't open dsspfile "1f2uD.bssp"
#ERROR : Can't open dsspfile "1f2uB.bssp"
#ERROR : Can't open dsspfile "1f2tB.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "1us8B.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"

## Summary of PDB Search
:242
    1e-47  42%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    3e-46  40%  2oukB  [x.x.x] PROTEIN ARTP
    3e-46  40%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    3e-36  36%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    9e-33  40%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-31  40%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    2e-31  40%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    7e-30  38%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-30  38%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-30  38%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-29  37%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-29  37%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-29  37%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-29  37%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-29  38%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    2e-29  38%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    4e-28  40%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    9e-28  38%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    4e-26  33%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    4e-26  33%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    1e-25  32%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    9e-25  39%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-24  42%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-23  34%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    1e-23  34%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    7e-22  39%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    5e-21  36%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    5e-21  36%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    6e-21  34%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    6e-21  34%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    1e-20  35%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-20  35%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-20  35%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-20  35%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-20  35%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    5e-20  35%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    7e-20  35%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    7e-20  35%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-19  32%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    7e-19  33%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    7e-19  31%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    7e-19  31%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    1e-18  33%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    3e-17  30%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    3e-17  27%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    4e-17  27%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    7e-17  29%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    7e-17  29%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    7e-17  27%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    2e-16  38%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-16  27%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    3e-15  28%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    4e-15  29%  1ji0A  [c.37.1] ABC TRANSPORTER
    4e-15  28%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    6e-15  30%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    1e-14  29%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-14  27%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-14  27%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    9e-14  31%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    9e-14  27%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    3e-13  32%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-13  27%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    8e-13  28%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    8e-13  28%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    8e-13  29%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    5e-12  31%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    7e-12  26%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-11  33%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-11  29%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    4e-11  36%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    2e-09  32%  1yqtA  [x.x.x] RNASE L INHIBITOR
    2e-09  26%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-09  38%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-09  38%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-08  28%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  29%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  2d2eA  [x.x.x] SUFC PROTEIN
    3e-08  25%  2d2fA  [x.x.x] SUFC PROTEIN
    6e-08  29%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-08  26%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-07  26%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-07  26%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-07  26%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-07  28%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-07  28%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-07  27%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-07  28%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    2e-07  28%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-07  31%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    2e-07  31%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    3e-07  28%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-07  27%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  27%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  27%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  28%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-07  34%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    5e-07  34%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    1e-06  26%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-06  26%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-06  29%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-06  25%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    5e-06  25%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    7e-06  29%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    9e-06  36%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    9e-06  36%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    9e-06  36%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    1e-04  37%  1ii8B  [c.37.1] RAD50 ABC-ATPASE
    1e-04  37%  1f2uD  [c.37.1] RAD50 ABC-ATPASE
    1e-04  37%  1f2uB  [c.37.1] RAD50 ABC-ATPASE
    1e-04  37%  1f2tB  [c.37.1] RAD50 ABC-ATPASE
    2e-04  32%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    2e-04  32%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    2e-04  32%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    2e-04  32%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    2e-04  32%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    4e-04  35%  1us8B  [c.37.1] DNA DOUBLE-STRAND BREAK REPAIR RAD50 ATPASE
    2e-04  33%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 157->223)
    2e-05  32%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 157->223)
:242

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSIQLNGINCFYGAHQALFDITLDCPEGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLTIAGNHFDFTK
1b0uA           -----------YGGHEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGQNINLVK
2oukB           --IDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLE----DFXXXXXXXXXXNL
2oljA           --IDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLE----DFXXXXXXXXXXNL
3dhwC           ---------------QALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELT---
2yyzA           -SIRVVNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEI-----YFD---
2it1B           VEIKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKI-----YFD---
2it1A           VEIKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKI-----YFD---
3fh6A           -SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP
2awoA           -SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP
2awnB           -SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP
1l2tB           ----------------ALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYI--DNIKTND
1l2tA           ----------------ALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYI--DNIKTND
2r6gB           -SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT-
2r6gA           -SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT-
2pcjA           --------------YEILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEVDYT-
1q12A           --VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP
3d31A           ----------------SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGK--DVTD
1f3oA           ----------------ALKNVNLNIKEGE-FVSIGPSGSGKSTL-NIIGCLDKPTEGEVYI--DNIKTND
1z47A           MTIEFVGVEKIYGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKR--VTD
1g291           -----------FGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIG----DKLV
1z47B           -TIEFVGVEKIYGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKR--VTD
2awoC           -------------------DINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP
2awnC           -------------------DINLDIHEGEFVVFVGPSGCGKSTLLRM-------------IAG-------
1oxvA           ----------------ALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELRLVASNGKLIV
1oxsC           ----------------ALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELRLVASNGKLIV
2onkA           ------------------FRLNVDFEMGDYCVLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGA--DITP
1mt0A           -----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGH------
2ff7A           -----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGH------
3fvqB           -----------------LNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTI-FSK
3fvqA           -----------------LNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTI-FSK
2yz2B           ---------------KALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGER-----
2yz2A           ---------------KALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGER-----
2fgkA           -----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGH------
2ffbA           -----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGH------
3b5jA           -----------------LDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGH------
2d62A           -----------FGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAG-LEEPTRGQIYIEDN---LVA
1xefA           -----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGH------
2ffaA           -----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGH------
1v43A           VEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYL-
3gfoA           ------------GTH-ALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPIDYSR
3g60A           -NVQFSGVVFNYPTRPSLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDG------K
3g5uA           -NVQFSGVVFNYPTRPSLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDG------K
2hydA           --IDIDHVSFQYNDNEALKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFL
1pf4A           ----------------ALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDV----
1g6hA           ----------YFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRV-----YFENKD
1g9xA           ----------YFGEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRV-----YFENKD
1mv5D           -------------SEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPID---
1mv5A           -------------SEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPID---
1gajA           ----------YFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRV-----YFENKD
2awnA           -SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT-
1oxxK           ----------------ALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELRLVASNGKLIV
2ixfD           ---------------QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGHHYLHTQ
1ji0A           --LEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQ--DITN
2ghiA           VNIEFSDVNFSYPKHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRF-YDAEGDIKIGGKNVNKYN
1jj7A           --------------------LTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKHRQVAA
2ixeD           ---------------QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGHHYLHTQ
2ixfC           ---------------QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEHTQVAA
2ixfA           ---------------QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEHTQVAA
2nq2C           -ALSVENLGFYYQAENFLFQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKI-----------
2ghiC           VNIEFSDVNFSYPKHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRF-YDAEGDIKIGGKNVNKYN
2nq2D           --------------YQAFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKI-----------
2ixeA           ---------------QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEHTQVAA
1vplA           -----------------------------------PNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEP
2ghiD           VNIEFSDVNFSY--HRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRF-YDAEGDIKIGGKNVNKYN
2ghiB           VNIEFSDVNFSYPKHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRF-YDAEGDIKIGGKNVNKYN
2ihyA           --------------------ISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGK------
2ixgA           ---------------QVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEHTQVAA
3bk7A           --------------------------KGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKLTVAYKP-QYIK
2ihyB           --------------------ISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGK-----P
2cbzA           --------------------ITFSIPEGALVAVVGQVGCGKSSLLSAL-LAEMDKEGHVAIKGS---VAY
1yqtA           --------------------------KGEVIGIVGPNGIGKTTFVKLAGV-EEPTEGKLTVAYKP-QYIK
2pzfA           --VVMENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2awoD           -SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT-
2awnD           -SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT-
2pzgB           --VVMENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2bbtB           -----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
1xfaA           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1xf9D           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1xf9C           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1xf9B           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1xf9A           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1r10A           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1r0zD           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1r0zC           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1r0zB           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1r0zA           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1r0xD           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1r0xC           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1r0xB           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1r0xA           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1r0wC           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1r0wB           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1r0wA           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1q3hD           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1q3hC           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1q3hB           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
1q3hA           ---------CLVG-NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLI-LGELEASEGIIKHSGRVSFCS
2d2eA           --------------------VNLVVPKGEVHALMGPNGAGKSTLGKILDPEYTVERGEILLDGENI-LEL
2d2fA           --------------------VNLVVPKGEVHALMGPNGAGKSTLGKILDPEYTVERGEILLDGENI-LEL
1xmiB           -----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2pzfB           --VVMENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2pzgA           --VVMENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2pzeB           --VVMENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2pzeA           --VVMENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2bbsB           -------------AFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2bbtA           -----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2bbsA           -----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2pjzA           ---------------------------GEKVIILGPNGSGKTTLLRAISGL-LPYSGNIFING-------
1xmiD           -----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2ix3A           -----------YGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIANGQVDGFPTQTVYVEH-DIDG
2iwhB           -----------YGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIANGQVDGFPTQTVYVEH-DIDG
2zu0C           --------------------LSLDVHPGEVHAIMGPNGSGKSTLSATLAGREEVTGGTVEFKGKDL-LAL
1xmiE           -----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
1xmiC           -----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
1xmiA           -----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2d3wA           --------------------LSLDVHPGEVHAIMGPNGSGKSTLSATLAGREEVTGGTVEFKGKDL-LAL
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
1xmjA           -----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2bboA           -----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2d3wB           --------------------LSLDVHPGEVHAIMGPNGSGKSTLSATLAGREEVTGGTVEFKGKDL-LAL
1z2rA           ----------------ALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDL----
3b60A           ----------------ALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDL----
2d3wD           --------------------LSLDVHPGEVHAIMGPNGSGKSTLSATLAGREEVTGGTVEFKGKDL-LAL
2ix8A           -------------------DINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSG-------------
2iw3B           -------------------DINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSG-------------
2iw3A           -------------------DINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSG-------------
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1us8B           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TPSDKAIRELRQNVGMVFQQYNLWPHLTVVQNLIEAPCRVLGLTKDQXXXXXXXXXXXXXXXPYSDRYPL
1b0uA           VADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKDARERALKYLAKVGIDERAQGKYPV
2oukB           KAKDTNLNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAKAMELLDKVGLKDKAHAYPD
2oljA           KAKDTNLNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAKAMELLDKVGLKDKAHAYPD
3dhwC           TLSESELTKARRQIGMIFQHFNLLSSRTVFGN-VALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPS
2yyzA           ---DVLVNDIPREVGMVFQNYALYPHMTVFEN-IAFPLRARRISKDEVEKRVVEIARKLLIDNLLDRKPT
2it1B           ---EKDVTELPRNVGLVFQNWALYPHMTVYKN-IAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPW
2it1A           ---EKDVTELPRNVGLVFQNWALYPHMTVYKN-IAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPW
3fh6A           -PAERG-------VGMVFQSYALYPHLSVAENM-SFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPK
2awoA           -PAERG-------VGMVFQSYALYPHLSVAENM-SFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPK
2awnB           -PAERG-------VGMVFQSYALYPHLSVAENM-SFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPK
1l2tB           LDDDELTKIRRDKIGFVFQQFNLIPLLTALEN-VELPLRGAMSGEERRKRALECLKMAELEERFANHKPN
1l2tA           LDDDELTKIRRDKIGFVFQQFNLIPLLTALEN-VELPLRGAMSGEERRKRALECLKMAELEERFANHKPN
2r6gB           PPAER-------GVGMVFQSYALYPHLSVAENM-SFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPK
2r6gA           PPAER-------GVGMVFQSYALYPHLSVAENM-SFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPK
2pcjA           --NEKELSLLRRKLGFVFQFHYLIPELTALENVI-VPMLKMGKPKKEAKERGEYLLSELGLGDKLSRKPY
1q12A           -PAERG-------VGMVFQSYALYPHLSVAENM-SFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPK
3d31A           LSPEK------HDIAFVYQNYSLFPHMNVKKNLIKDPKRVLDTARDLKIEHLL------------DRNPL
1f3oA           LDDDELTKIRRDKIGFVFQQFNLIPLLTALEN-VELPLKYRGASGEERRKRALECLKAELEERFANHKPN
1z47A           LPPQK------RNVGLVFQNYALFQHMTVYDN-VSFGLREKRVPKDEMDARVRELLRFMRLESYANRFPH
1g291           ADPEKGIPPKDRDIAMVFQSYALYPHMTVYDN-IAFPLKLRKVPRQEIDQRVREVAELLGLTELLNRKPR
1z47B           LPPQK------RNVGLVFQNYALFQHMTVYDN-VSFGLREKRVPKDEMDARVRELLRFMRLESYANRFPH
2awoC           -PAERG-------VGMVA----LYPHLSVAENM-SFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPK
2awnC           -----------LGVGMVFQSYALYPHLSVAENM-SFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPK
1oxvA           PPEDRKI-------GMVFQTWALYPNLTAFEN-IAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPR
1oxsC           PPEDRKI-------GMVFQTWALYPNLTAFEN-IAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPR
2onkA           LPPE------RRGIGFVPQDYALFPHLSVYRNIAYG---LXXXXXXXXXXXXXXMAEKLGIAHLLDRKPA
1mt0A           ---DLALADLRRQVGVVLQD-NVLLNRSIIDNISLANP---GMSVEKVIYAAKLAGAHDFISELREGYNT
2ff7A           ---DLALADLRRQVGVVLQD-NVLLNRSIIDNISLANP---GMSVEKVIYAAKLAGAHDFISELREGYNT
3fvqB           N-TNLPVRERR--LGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTA-QERQRIEAMLELTGISELAGRYPH
3fvqA           N-TNLPVRERR--LGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTA-QERQRIEAMLELTGISELAGRYPH
2yz2B           ----KKGYEIRRNIGIAFQYKNFYPDRDPVP-LVKKAMEFVGLDFDS----------------FKDRVPF
2yz2A           ----KKGYEIRRNIGIAFQYKNFYPDRDPVP-LVKKAMEFVGLDFDS----------------FKDRVPF
2fgkA           ---DLALADLRRQVGVVLQD-NVLLNRSIIDNISLANP---GMSVEKVIYAAKLAGAHDFISELREGYNT
2ffbA           ---DLALADLRRQVGVVLQD-NVLLNRSIIDNISLANP---GMSVEKVIYAAKLAGAHDFISELREGYNT
3b5jA           ---DLALADLRRQVGVVLQD-NVLLNRSIIDNISLANP---GMSVEKVIYAAKLAGAHDFISELREGYNT
2d62A           DPEKGVFVPPKERDVAVFQSYALYPH-TVYDN-IAFPLKLRKVPK-QEIDKRVREVAELGLTELLNRKPR
1xefA           ---DLALADLRRQVGVVLQD-NVLLNRSIIDNISLANP---GMSVEKVIYAAKLAGAHDFISELREGYNT
2ffaA           ---DLALADLRRQVGVVLQD-NVLLNRSIIDNISLANP---GMSVEKVIYAAKLAGAHDFISELREGYNT
1v43A           PPKDR-------NISMVFQ------HMTVYEN-IAFPLK--KFPKDEIDKRVRWAAELLQIEELLNRYPA
3gfoA           ----KGIMKLRESIGIVFQDPDNQLFSASVYQDVSFGAVNMKLPEDEIRKRVDNALKRTGIEHLKDKPTH
3g60A           EIKQLNVQWLRAQLGIVSQEPILFD-CSIAENIAYGDSRVVSYEEIVRAAKEANIHQFIDSLP--DKYNT
3g5uA           EIKQLNVQWLRAQLGIVSQEPILFD-CSIAENIAYGDSRVVSYEEIVRAAKEANIHQFIDSLP--DKYNT
2hydA           TGS------LRNQIGLV-QQDNILFSDTVKENILATDEEVVEAAKMANAHDFIMNLPQGYDTEVGER-GV
1pf4A           --RDYKLTNLRRHFALVSQNVHLFND-TIANNIAYAAEGEYTREQIEQAARQAHAMEFIENMPQGGENGT
1g6hA           ITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLESPLNSLFYKKEEMVEKAFKILEFLKLSHLYDRKAG
1g9xA           ITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLESPLNSLFYKKEEMVEKAFKILEFLKLSHLYDRKAG
1mv5D           ---NISLENWRSQIGFVSQDSAIMAG-TIRENL------TYGLEGDYTDEDLWQVLDLAFARSFVENMPV
1mv5A           ---NISLENWRSQIGFVSQDSAIMAG-TIRENL------TYGLEGDYTDEDLWQVLDLAFARSFVENMPV
1gajA           ITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLESPLNSLFYKKEEMVEKAFKILEFLKLSHLYDRKAG
2awnA           PPAER-------GVGMVFQSY----ALEVINQRVNQVAEVL-----------------------------
1oxxK           PPEDR-------KIGMVFQTWALYPNLTAFEN-IAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPR
2ixfD           VAAVGQLRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGN--------------
1ji0A           KPA----HVINRGIALVPEGRRIFPELTVYENLGAYN------RKDKEGIKRDLEWIFSLFPRLKERLKQ
2ghiA           RNSIRSI------IGIVPQDTILFNE-TIKYNILYGKLEVIKATKSAQLYDFIEALPKKWDTIVGNK-GM
1jj7A           VGQEPQVRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEV--------------DEAGS
2ixeD           VAAVGPLRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGF-------------------PQGYDTEV
2ixfC           VGQEPLLRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGN--------------
2ixfA           VGQEPLLRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGN--------------
2nq2C           --------EVYQSIGFVPQFFSAYSVLDIVLMGRSTHINTFAKPKSHDYQVAMQALDYLNLTHLAKREFT
2ghiC           RNSIRSI------IGIVPQDFNETIKYNILYGKLDATEEVIKATKSAQLYDFIEALPKKW-----DTIVG
2nq2D           --------EVYQSIGFVPQFFSAYSVLDIVLMGRSTHINTFAKPKSHDYQVAMQALDYLNLTHLAKREFT
2ixeA           VGQEPLLRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGN--------------
1vplA           HEVRKLISYLPEEAGAYRNMQGIESSSSEIEEMVERATEIAGLGEK-----------------IKDRVST
2ghiD           RNSIRSI------IGIVPQDTILFNE-TIKYNILYGK---LDATDEEVIKATKSAQLYDFIEALPKKWDI
2ghiB           RNS------IRSIIGIVPQDTILF-NETIKYNILYGKLEVIKATKSAQLYDFIEALPKKWDTIVGNK--M
2ihyA           -PGYSA-ETVRQHIG--FVSHSLLEKFQEGERVIDV---VISGAIDDEIRNEAHQLLKLVGSAKAQQYIG
2ixgA           VGQEPLLRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGN--------------
3bk7A           AEYEGTVYELLSKIDSSKLNSNFY------KTELLKPLGIIDLY---------------------DRNVE
2ihyB           GKVGYSAETVRQHIGFVSHSLKFQEGERVIDVVISGAFKSIGVYQDDEIRNEAHQLLKLVGSAKAQQYIG
2cbzA           VPQQAWIQNLRENILFGCQLEEPY-----YRSVIQA-CALL---------------PDLEILPSGDRTEI
1yqtA           ADYEGTVYELLSKIDASKLNSNFY------KTELLKPLGIIDLY---------------------DREVN
2pzfA           QFSWIMPGTIKENIGVSYDEYRY-------RSVIKA-CQ---LEEDISKFAEKDNIVLGEGG-------I
2awoD           PPAERGVGMVEPSV--------------------------------------------------------
2awnD           PPAERGVGMVEPSV--------------------------------------------------------
2pzgB           QFSWIMPGTIKENIGVSYDEYRYRSVIKACQKFAEKDNIVLGIT--------------------------
2bbtB           QNSWIMPGTIKENIGVSYDEYRYRSVIKACQKFAEKDNIVLGIT--------------------------
1xfaA           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1xf9D           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1xf9C           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1xf9B           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1xf9A           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1r10A           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1r0zD           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1r0zC           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1r0zB           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1r0zA           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1r0xD           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1r0xC           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1r0xB           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1r0xA           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1r0wC           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1r0wB           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1r0wA           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1q3hD           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1q3hC           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1q3hB           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
1q3hA           QFSWIMPGTIKENIGVSYDEYRY-------KSVVKACQLQQDITKFAEQDNTVLGEGG-----------V
2d2eA           SPDERA----RKGLFLAF-QYPVVPGVTIANFLRLALQAKLGRVAEFWTKVKKALELLDWDESYLSRY--
2d2fA           SPDERA----RKGLFLAFQYPVEVPGVTIANFLRLALQAKLGRVAEFWTKVKKALELLDWDESYLSRYLN
1xmiB           QFSWIMPGTIKENIGVSYDEYRY-------RSVIKA-CQ---LEED------------------ISKIVL
2pzfB           QFSWIMPGTIKENIGVSYDEYRY-------RSVIKA-CQ---LEEDISKFAEKDNIVLGEGG-------I
2pzgA           QFSWIMPGTIKENIGVSYDEYRY-------RSVIKA-CQ---LEEDISKFAEKDNIVLGEGG-------I
2pzeB           QFSWIMPGTIKENIGVSYDEYRY-------RSVIKA-CQ---LEEDISKFAEKDNIVLGEGG-------I
2pzeA           QFSWIMPGTIKENIGVSYDEYRY-------RSVIKA-CQ---LEEDISKFAEKDNIVLGEGG-------I
2bbsB           QNSWIMPGTIKENIGVSYDEYRYRSVIKACQKFAEKDNIVLG--------------------------GI
2bbtA           QNSWIMPGTIKENIGVSYDEYRYRSVIKACQKFAEKDNIVLG--------------------------GI
2bbsA           QNSWIMPGTIKENIGVSYDEYRY-------RSVIKA-CQ---LEEDISKFAEKDNIVL-----------I
2pjzA           ----MEVRKIRNYIRYSTNLPEAYEIGVTVNDIVYLYEELKGLDRD---LFLEMLKALKLGEEILRRKLY
1xmiD           QFSWIMPGTIKENIGVSYDEYRYRSVIKACQKFAEKDNIVLG--------------------------EI
2ix3A           THSDTSVLDFVFESGVGTKE-------AIKDKLIE-----FGFTDEMIAM------------PISA----
2iwhB           THSDTSVLDFVFESGVGTKE-------AIKDKLIE-----FGFTDEMIAM------------PISA----
2zu0C           SPEDRA----GEGIFMAFQQFFLQTALNAVQDLMEEKIALLKMPEDLLTRSVN----------------V
1xmiE           QFSWIMPGTIKENIGVSYDEYRY-------RSVIKA-CQ---LEEDISKFAEKDNIVLGEGG-------I
1xmiC           QFSWIMPGTIKENIGVSYDEYRY-------RSVIKA-CQ---LEEDISKFAEKDNIVLGEGG-------I
1xmiA           QFSWIMPGTIKENIGVSYDEYRY-------RSVIKA-CQ---LEEDISKFAEKDNIVLGEGG-------I
2d3wA           SPEDRA----GEGIFMAFQQFFLQTALNAVQDLMEEKIALLKMPEDLLTRSVN----------------V
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
1xmjA           QFSWIMPGTIKENIGVSYDEYRY-------RSVIKA-CQ---LEEDISKFAEKDNIVLGEGG-------I
2bboA           QFSWIMPGTIKENIGVSYDEYRY-------RSVIKA-CQ---LEEDISKFAEKDNIVLGEGG-------I
2d3wB           SPEDRA----GEGIFMAFQQFFLQTALNAVQDLMEEKIALLKMPEDLLTRSVN----------------V
1z2rA           --REYTLASLRNQVALVSQNVHLF-NDTVANNI--AYARTEEYSREQIEEAARMAYAMDFINKMDNENGV
3b60A           --REYTLASLRNQVALVSQNVHLF-NDTVANNI--AYARTEEYSREQIEEAARMAYAMDFINKMDNENGV
2d3wD           SPEDRA----GEGIFMAFQQFFLQTALNAVQDLMEEKIALLKMPEDLLTRSVN----------------V
2ix8A           --------------------------------------------------------------------PI
2iw3B           --------------------------------------------------------------------PI
2iw3A           --------------------------------------------------------------------PI
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1us8B           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           HLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIHELAETNITQVIVTHEVEVARKTASR
1b0uA           HLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSH
2oukB           SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDR
2oljA           SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDR
3dhwC           NLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDIRRLGLTILLITHEMDVVKRICDC
2yyzA           QLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMAEIKHLQQELGITSVYVTHDQAEAMTMASR
2it1B           QLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLKELGITTVYVTHDQAEALAMADR
2it1A           QLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLKELGITTVYVTHDQAEALAMADR
3fh6A           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMISRLHK--RLGRTMIYVTHDQVEAMTLADK
2awoA           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMISRLHK--RLGRTMIYVTHDQVEAMTLADK
2awnB           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMISRLHK--RLGRTMIYVTHDQVEAMTLADK
1l2tB           QLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLEEDGKTVVVVTHDINVAR-FGER
1l2tA           QLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLEEDGKTVVVVTHDINVAR-FGER
2r6gB           ALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMISRLHK--RLGRTMIYVTHDQVEAMTLADK
2r6gA           ALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMISRLHK--RLGRTMIYVTHDQVEAMTLADK
2pcjA           ELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVMVTHERELAELT-HR
1q12A           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMISRLHK--RLGRTMIYVTHDQVEAMTLADK
3d31A           TLSGGEQQRVALARALVTNPKILLLDEPLSALDPENAREMLSVLHK--KNKLTVLHITHDQTEARIMADR
1f3oA           QLSGGQQQRVAIARALANNPPIILADEPTGALDSK-TGEKIQLLKKLEEDGKTVVVVTHDINVAR-FGER
1z47A           ELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVDEMGVTSVFVTHDQEEALEVADR
1g291           ELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLRQLGVTTIYVTHDQVEAMTMGDR
1z47B           ELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVDEMGVTSVFVTHDQEEALEVADR
2awoC           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMISRLHK--RLGRTMIYVTHDQVEAMTLADK
2awnC           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMISRLHK--RLGRTMIYVTHDQVEAMTLADK
1oxvA           ELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVSRLGVTLLVVSHD----------
1oxsC           ELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVSRLGVTLLVVSHD----------
2onkA           RLSGGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVREFDVPILHVTHDLIEAAMLADE
1mt0A           GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGR-TVIIIAHRLSTV-KNADR
2ff7A           GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGR-TVIIIAHRLSTV-KNADR
3fvqB           ELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIEDMIAALRANGKSAVFVSHDREEALQYADR
3fvqA           ELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIEDMIAALRANGKSAVFVSHDREEALQYADR
2yz2B           FLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDR
2yz2A           FLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDR
2fgkA           GLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGR-TVIIIAHRLSTV-KNADR
2ffbA           GLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGR-TVIIIAHRLSTV-KNADR
3b5jA           GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGR-TVIIIAHRLSTV-KNADR
2d62A           ELSGGQRQRVALGRAIIRRPKVFL-DEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHD----------
1xefA           GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTV--KNADR
2ffaA           GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLSTV--KNADR
1v43A           QLSGGXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQLKVTTIYVTHDQVEAMTMGDR
3gfoA           CLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEM-----------------------
3g60A           RLSGGQKQRIAIARALVRQPHILLLDEATSALDTE-SEKVVQEALDKAREGRTCIVIAHRLSTI-QNADL
3g5uA           RLSGGQKQRIAIARALVRQPHILLLDEATSALDTE-SEKVVQEALDKAREGRTCIVIAHRLSTI-QNADL
2hydA           KLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDR-TTLIVAHRLSTITH-ADK
1pf4A           SLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDEL-QKNKTVLVIAHRLSTIEQ-ADE
1g6hA           ELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDH
1g9xA           ELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDH
1mv5D           KISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGR-TTLVIAHRLSTI-VDADK
1mv5A           KISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGR-TTLVIAHRLSTI-VDADK
1gajA           ELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDH
2awnA           ----------AIGRTLVAEPSVFLLDEPLSNLDAALRVQMISRLHK--RLGRTMIYVTHDQVEAMTLADK
1oxxK           ELSGXXXXXXXXXXXXXKDPSLLLLDEPFSNLDARMRDSARALVKEVSRLGVTLLVVSHD----------
2ixfD           QLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEASRTVLLITHQLSLAER-AHH
1ji0A           TLSGGEQQ-LAIGRAL-SRPKLL--DEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHY
2ghiA           KLSGGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRK-NRTLIIIAHRLSTI-SSAES
1jj7A           QLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADH
2ixeD           QLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEASRTVLLITQQLSLAER-AHH
2ixfC           QLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEASRTVLLITHQLSLAER-AHH
2ixfA           QLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEASRTVLLITHQLSLAER-AHH
2nq2C           SLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSNMTVVFTTHQVAIANKT---
2ghiC           GMKLGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRK-NRTLIIIAHRLSTI-SSAES
2nq2D           SLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSNMTVVFTTHQVAIANKT---
2ixeA           QLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEASRTVLLITQQLSLAER-AHH
1vplA           Y-SKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEVEFLCDR
2ghiD           VLSGGERQRIAIARCLLKDPKIVIFDD----------SKTEYLFQKAVEDNRTLIIIAHRLSTI-SSAES
2ghiB           KLSGGERQRIAIARCLLKDPKIVIFDEATSDSKTEYLFQ--KAVEDLRK-NRTLIIIAHR---TISSAES
2ihyA           YLSTGEKQRV-IARAL-GQPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIVTHFIEEITANFSK
2ixgA           QLAVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEASRTVLLITQQLSLAER-AHH
3bk7A           DLSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNKTALVVEHDVLMIDYVSDR
2ihyB           YLSTGEKQRV-IARAL-GQPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIVTHFIEEITANFSK
2cbzA           NLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFEIGPKGMLKNKTRILVTHSMSYLPQ-VDV
1yqtA           ELSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKNEKTALVVEHDV---------
2pzfA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2pzgB           -LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
2bbtB           -LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
1xfaA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1xf9D           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1xf9C           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1xf9B           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1xf9A           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1r10A           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1r0zD           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1r0zC           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1r0zB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1r0zA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1r0xD           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1r0xC           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1r0xB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1r0xA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1r0wC           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1r0wB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1r0wA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1q3hD           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1q3hC           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1q3hB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
1q3hA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADK
2d2eA           -LNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYQPDK
2d2fA           EFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYQPDK
1xmiB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
2pzfB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
2pzgA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
2pzeB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
2pzeA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
2bbsB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
2bbtA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
2bbsA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
2pjzA           KLSAGQSVLVRTSLALASQPEIVGLDEPFENVDAARRHVISRYIKEYGKEGI---LVTHELDM-------
1xmiD           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
2ix3A           -LSGGWKMKLALARAVLRNADILLLDEPTNHLD---TVNVAWLVNYLNTCGITSITISHD----------
2iwhB           -LSGGWKMKLALARAVLRNADILLLDEPTNHLD---TVNVAWLVNYLNTCGITSITISHD----------
2zu0C           GFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPD
1xmiE           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
1xmiC           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
1xmiA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
2d3wA           GFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPD
2r6fB           -LSGGEAQRVKLAAELHRRSNLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVI-KTADY
2r6fA           -LSGGEAQRVKLAAELHRRSNLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVI-KTADY
1xmjA           TLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
2bboA           TLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADK
2d3wB           GFSGGEKKRNDILQMAVLEPELCILDE-SDSLDIDALKVVADGVNSLRDGKRSFIIVTHYRILDYIKPDY
1z2rA           LLSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDEL-QKNRTSLVIAHRL---------
3b60A           LLSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDEL-QKNRTSLVIAHRL---------
2d3wD           GFSGGEKKRNDILQMAVLEPELCILDE-SDGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPD
2ix8A           SALSGGWKKLALARAVLRNADILLLDEPTNHLD---TVNVAWLVNYLNTCGITSITISHD----------
2iw3B           SALSGGWKKLALARAVLRNADILLLDEPTNHLD---TVNVAWLVNYLNTCGITSITISHD----------
2iw3A           SALSGGWKKLALARAVLRNADILLLDEPTNHLD---TVNVAWLVNYLNTCGITSITISHD----------
1ii8B           -LSGGERIALGLAFRLAMEISLLILDEPTPYLDEERRRKLITIMERYLK-KIPQVILVSHDEELKDAADH
1f2uD           -LSGGERIALGLAFRLAMEISLLILDEPTPYLDEERRRKLITIMERYLK-KIPQVILVSHDEELKDAADH
1f2uB           -LSGGERIALGLAFRLAMEISLLILDEPTPYLDEERRRKLITIMERYLK-KIPQVILVSHDEELKDAADH
1f2tB           -LSGGERIALGLAFRLAMEISLLILDEPTPYLDEERRRKLITIMERYLK-KIPQVILVSHDEELKDAADH
2vf8B           -LSPGELQRLRLATQLYSNGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVEHDLDVIRR----
2vf8A           -LSPGELQRLRLATQLYSNGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVEHDLDVIRR----
2vf7C           -LSPGELQRLRLATQLYSNGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVEHDLDVIRR----
2vf7B           -LSPGELQRLRLATQLYSNGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVEHDLDVIRR----
2vf7A           -LSPGELQRLRLATQLYSNGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVEHDLDVIRR----
1us8B           --------RLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLK-KIPQVILVSHDEELKDAADH
2awoD           ----------------MVEPSVFLLDEPDAALRVQMRIEISRLHKRLGR---TMIYVTHDQVEAMTLADK
2awnD           ----------------MVEPSVFLLDEPLSNLDAALRVQMISRLHK--RLGRTMIYVTHDQVEAMTLADK


                         .         .         .         +         .         .         .:280
query           VIYMENGHIVEHGDAGCFAHPQTEAFKNYLSx
1b0uA           VIFLHQGKIEEEGDEQVFGNPQSPRLQQFL--
2oukB           VLFMDGGYIIEEGPEDLFDRPQHERTKAFLS-
2oljA           VLFMDGGYIIEEGPEDLFDRPQHERTKAFLS-
3dhwC           VAVISNGELIEQDTVSVFSHPKTPLAQKFI--
2yyzA           IAVFNQGKLVQYG-------------------
2it1B           IAVIREGEILQVG-------------------
2it1A           IAVIREGEILQVG-------------------
3fh6A           IVVLDAGRVAQVG-------------------
2awoA           IVVLDAGRVAQVG-------------------
2awnB           IVVLDAGRVAQVG-------------------
1l2tB           IIYLKDGEV-----------------------
1l2tA           IIYLKDGEV-----------------------
2r6gB           IVVLDAGRVAQVG-------------------
2r6gA           IVVLDAGRVAQVG-------------------
2pcjA           TLEMKDGKVV----------------------
1q12A           IVVLDAGRVAQVG-------------------
3d31A           IAVVMDGKLIQVG-------------------
1f3oA           IIYLKDGEV-----------------------
1z47A           VLVLHEGNVEQFG-------------------
1g291           IAVMNRGVLQQVG-------------------
1z47B           VLVLHEGNVEQFG-------------------
2awoC           IVVLDAGRVAQVG-------------------
2awnC           IVVLDAGRVAQVG-------------------
1oxvA           --------------------------------
1oxsC           --------------------------------
2onkA           VAVMLNGRIVEKG-------------------
1mt0A           IIVMEKGKIVEQG-------------------
2ff7A           IIVMEKGKIVEQG-------------------
3fvqB           IAVMKQGRILQ---------------------
3fvqA           IAVMKQGRILQ---------------------
2yz2B           VVVLEKGKKVFDG-------------------
2yz2A           VVVLEKGKKVFDG-------------------
2fgkA           IIVMEKGKIVEQG-------------------
2ffbA           IIVMEKGKIVEQG-------------------
3b5jA           IIVMEKGKIVEQG-------------------
2d62A           --------------------------------
1xefA           IIVMEKGKIVEQG-------------------
2ffaA           IIVMEKGKIVEQG-------------------
1v43A           IAVMNRGQLLQIG-------------------
3gfoA           --------------------------------
3g60A           IVVIQNGKVKEHG-------------------
3g5uA           IVVIQNGKVKEHG-------------------
2hydA           IVVIENGHIVETG-------------------
1pf4A           ILVVDEGEIIERG-------------------
1g6hA           LYVMFNGQIIAEGRG-------EEEIKNVLS-
1g9xA           LYVMFNGQIIAEGRG-------EEEIKNVLS-
1mv5D           IYFIEKGQITGSG-------------------
1mv5A           IYFIEKGQITGSG-------------------
1gajA           LYVMFNGQIIAEGRG-------EEEIKNVLS-
2awnA           IVVLDAGRVAQVG-------------------
1oxxK           --------------------------------
2ixfD           ILFLKEGSVCEQG-------------------
1ji0A           GYVLETGQIVLEGKA-----------------
2ghiA           IILLNKGKIVEKG-------------------
1jj7A           ILFLEGGAIREGG-------------------
2ixeD           ILFLKEGSVCEQG-------------------
2ixfC           ILFLKEGSVCEQG-------------------
2ixfA           ILFLKEGSVCEQG-------------------
2nq2C           --------------------------------
2ghiC           IILLNKGKIVEKG-------------------
2nq2D           --------------------------------
2ixeA           ILFLKEGSVCEQG-------------------
1vplA           IALIHNGTIVETG-------------------
2ghiD           IILLNKGKIVEKG-------------------
2ghiB           IILLNKGKIVEKG-------------------
2ihyA           ILLLKDGQSIQQG-------------------
2ixgA           ILFLKEGSVCEQG-------------------
3bk7A           LIVFE-GEPGRHGRA-----------------
2ihyB           ILLLKDGQSIQQG-------------------
2cbzA           IIVMSGGKISEMG-------------------
1yqtA           --------------------------------
2pzfA           ILILHEGSSYFYG-------------------
2awoD           --------------------------------
2awnD           --------------------------------
2pzgB           ILILHEGSSYFYG-------------------
2bbtB           ILILHEGSSYFYG-------------------
1xfaA           ILILHQGSSYFYG-------------------
1xf9D           ILILHQGSSYFYG-------------------
1xf9C           ILILHQGSSYFYG-------------------
1xf9B           ILILHQGSSYFYG-------------------
1xf9A           ILILHQGSSYFYG-------------------
1r10A           ILILHQGSSYFYG-------------------
1r0zD           ILILHQGSSYFYG-------------------
1r0zC           ILILHQGSSYFYG-------------------
1r0zB           ILILHQGSSYFYG-------------------
1r0zA           ILILHQGSSYFYG-------------------
1r0xD           ILILHQGSSYFYG-------------------
1r0xC           ILILHQGSSYFYG-------------------
1r0xB           ILILHQGSSYFYG-------------------
1r0xA           ILILHQGSSYFYG-------------------
1r0wC           ILILHQGSSYFYG-------------------
1r0wB           ILILHQGSSYFYG-------------------
1r0wA           ILILHQGSSYFYG-------------------
1q3hD           ILILHQGSSYFYG-------------------
1q3hC           ILILHQGSSYFYG-------------------
1q3hB           ILILHQGSSYFYG-------------------
1q3hA           ILILHQGSSYFYG-------------------
2d2eA           VHVMMDGRVVATG-------------------
2d2fA           VHVMMDGRVVATG-------------------
1xmiB           ILILHEGSSYFYG-------------------
2pzfB           ILILHEGSSYFYG-------------------
2pzgA           ILILHEGSSYFYG-------------------
2pzeB           ILILHEGSSYFYG-------------------
2pzeA           ILILHEGSSYFYG-------------------
2bbsB           ILILHEGSSYFYG-------------------
2bbtA           ILILHEGSSYFYG-------------------
2bbsA           ILILHEGSSYFYG-------------------
2pjzA           --------------------------------
1xmiD           ILILHEGSSYFYG-------------------
2ix3A           --------------------------------
2iwhB           --------------------------------
2zu0C           YVHLYQGRIVKSGD------------------
1xmiE           ILILHEGSSYFYG-------------------
1xmiC           ILILHEGSSYFYG-------------------
1xmiA           ILILHEGSSYFYG-------------------
2d3wA           YVHLYQGRIVKSGD------------------
2r6fB           II------------------------------
2r6fA           II------------------------------
1xmjA           ILILHEGSSYFYG-------------------
2bboA           ILILHEGSSYFYG-------------------
2d3wB           VHVLYQGRIVKSGD------------------
1z2rA           --------------------------------
3b60A           --------------------------------
2d3wD           YVHLYQGRIVKSGD------------------
2ix8A           --------------------------------
2iw3B           --------------------------------
2iw3A           --------------------------------
1ii8B           VISLENG-------------------------
1f2uD           VISLENG-------------------------
1f2uB           VISLENG-------------------------
1f2tB           VISLENG-------------------------
2vf8B           --------------------------------
2vf8A           --------------------------------
2vf7C           --------------------------------
2vf7B           --------------------------------
2vf7A           --------------------------------
1us8B           VISLENG-------------------------
2awoD           IVVLDAGRVAQVG-------------------
2awnD           IVVLDAGRVAQVG-------------------