[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF67786.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c9iB.bssp"
#ERROR : Can't open dsspfile "3c9iA.bssp"
#ERROR : Can't open dsspfile "2pohA.bssp"
#ERROR : Can't open dsspfile "3c9iE.bssp"
#ERROR : Can't open dsspfile "3c9iD.bssp"
#ERROR : Can't open dsspfile "3c9iF.bssp"

## Summary of PDB Search
:233
    e-128 100%  3c9iB  [x.x.x] TAIL NEEDLE PROTEIN GP26
    e-128 100%  3c9iA  [x.x.x] TAIL NEEDLE PROTEIN GP26
    e-125 100%  2pohA  [x.x.x] HEAD COMPLETION PROTEIN
    e-119 100%  3c9iE  [x.x.x] TAIL NEEDLE PROTEIN GP26
    e-118 100%  3c9iD  [x.x.x] TAIL NEEDLE PROTEIN GP26
    e-118 100%  3c9iF  [x.x.x] TAIL NEEDLE PROTEIN GP26
:233

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVEL
3c9iB           MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVEL
3c9iA           MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVEL
2pohA           -ADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVEL
3c9iE           MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVEL
3c9iD           MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVEL
3c9iF           MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVEL


                         .         .         *         .         .         .         .:140
query           ADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADY
3c9iB           ADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADY
3c9iA           ADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADY
2pohA           ADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADY
3c9iE           ADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADY
3c9iD           ADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADY
3c9iF           ADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADY


                         +         .         .         .         .         *         .:210
query           VSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAATGTANKGVFDADLTFAVSDTYTQSEIQAIAN
3c9iB           VSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAATGTANKGVFDADLTFAVSDTYTQSEIQAIAN
3c9iA           VSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAATGTANKGVFDADLTFAVSDTYTQSEIQAIAN
2pohA           VSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAATGTANKGVFDADLTFAVSDTYTQSEIQAIAN
3c9iE           VSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAATGTANKGVFDADLTFA-----------AIAN
3c9iD           VSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAATGTANKGVFDADLTF------------AIAN
3c9iF           VSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAATGTANKGVFDA------------SEIQAIAN


                         .         .         .         +         .         .         .:280
query           ALITERRRTKALEDALRAHGLID
3c9iB           ALITERRRTKAMEDALRAHGLID
3c9iA           ALITERRRTKAMEDALRAHGLID
2pohA           ALITERRRTKA-EDALRAHGLID
3c9iE           ALITERRRTKAMEDALRAHGLID
3c9iD           ALITERRRTKAMEDALRAHGLID
3c9iF           ALITERRRTKAMEDALRAHGLID