[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:mic

[Show Plain Result]

#ERROR : Can't open dsspfile "3bp8B.bssp"
#ERROR : Can't open dsspfile "3bp8A.bssp"
#ERROR : Can't open dsspfile "1z6rA.bssp"
#ERROR : Can't open dsspfile "1z05A.bssp"
#ERROR : Can't open dsspfile "3eo3A.bssp"
#ERROR : Can't open dsspfile "3eo3C.bssp"
#ERROR : Can't open dsspfile "3eo3B.bssp"
#ERROR : Can't open dsspfile "2qm1B.bssp"
#ERROR : Can't open dsspfile "2qm1A.bssp"
#ERROR : Can't open dsspfile "2hoeA.bssp"
#ERROR : Can't open dsspfile "1woqA.bssp"
#ERROR : Can't open dsspfile "2ap1A.bssp"
#ERROR : Can't open dsspfile "2aa4A.bssp"

## Summary of PDB Search
:406
      0.0  89%  3bp8B  [x.x.x] PUTATIVE NAGC-LIKE TRANSCRIPTIONAL REGULATOR
      0.0  86%  3bp8A  [x.x.x] PUTATIVE NAGC-LIKE TRANSCRIPTIONAL REGULATOR
    e-176  89%  1z6rA  [x.x.x] MLC PROTEIN
    e-103  44%  1z05A  [x.x.x] TRANSCRIPTIONAL REGULATOR, ROK FAMILY
    2e-14  28%  3eo3A  [x.x.x] BIFUNCTIONAL UDP-N-ACETYLGLUCOSAMINE 2-
    3e-14  27%  3eo3C  [x.x.x] BIFUNCTIONAL UDP-N-ACETYLGLUCOSAMINE 2-
    7e-14  27%  3eo3B  [x.x.x] BIFUNCTIONAL UDP-N-ACETYLGLUCOSAMINE 2-
    8e-13  22%  2qm1B  [x.x.x] GLUCOKINASE
    8e-13  22%  2qm1A  [x.x.x] GLUCOKINASE
    5e-10  25%  2hoeA  [x.x.x] N-ACETYLGLUCOSAMINE KINASE
    3e-07  33%  1woqA  [c.55.1 - c.55.1] INORGANIC
    5e-04  28%  2ap1A  [x.x.x] PUTATIVE REGULATOR PROTEIN
    5e-04  59%  2aa4A  [x.x.x] PUTATIVE N-ACETYLMANNOSAMINE KINASE
:406

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxDQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEIKEAGS
3bp8B           -----------QIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQEL-------
3bp8A           ----------DQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHXXXXXXXXXXXX
1z6rA           -----------QIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVHE-LEAHLVQEL-------
1z05A           ----------DHIKQINAGRVYKLIDQKGPISRIDLSKESELAPASITKITRELIDAHLIHETTVQEAIS
3eo3A           ----------------------------------------------------------------------
3eo3C           ----------------------------------------------------------------------
3eo3B           ----------------------------------------------------------------------
2qm1B           ----------------------------------------------------------------------
2qm1A           ----------------------------------------------------------------------
2hoeA           -----------------------------PVSRVELAEELGLTKTTVGEIAKIFLEKGIVVEEK-----D
1woqA           ----------------------------------------------------------------------
2ap1A           ----------------------------------------------------------------------
2aa4A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RGRPAVGLMVETEAWHYLSIRISRGEIFLALRDLSSKLVVXXXXXXXXXXXXXXXXRIITHVDRFFTRHQ
3bp8B           -----VGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDSPLLDRIISHIDQFFIRHQ
3bp8A           XX-----------AWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDSPLLDRIISHIDQFFIRHQ
1z6rA           ------GLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDLPLLDRIISHIDQFFIRHQ
1z05A           RGRPAVGLQTNNLGWQFLSMRLGRGYLTIALHELGGEVLIDTKIDIHEIDQDDVLARLLFEIEEFFQTYA
3eo3A           ----------------------------------------------------------------------
3eo3C           ----------------------------------------------------------------------
3eo3B           ----------------------------------------------------------------------
2qm1B           ----------------------------------------------------------------------
2qm1A           ----------------------------------------------------------------------
2hoeA           SPRPTKSLKISPNCAYVLGIEVTRDEIAACLID-ASNILAHEAHPLPSQSDREETLNVYRIIDR--AKDE
1woqA           ----------------------------------------------------------------------
2ap1A           ----------------------------------------------------------------------
2aa4A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QKLERLTSIAITLPGIIDTENGVVHRMPYYEDVKEMPLGDALERHTGVPVYIQHDISAWTMAEALFGASR
3bp8B           KKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASR
3bp8A           KKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASR
1z6rA           KKLERLTSIAITLPGIIDTENGIVHR-PFYEDVKE-PLGEALEQHTGVPVYIQHDISAWT-AEALFGASR
1z05A           AQLDRVTSIAITLPGLVNSEQGIVLQMPHY-NVKNLALGPEIYKATGLPVFVANDTRAWALAEKLFGHSQ
3eo3A           ------------------------------------PLSDTLH----LPVWVDNDGNCAALAERKFGQGK
3eo3C           ------------------------------------PLSDTLH----LPVWVDNDGNCAALAERKFGQGK
3eo3B           ------------------------------------PLSDTLH----LPVWVDNDGNCAALAERKFGQGK
2qm1B           -------------PGSVDIEKGTVVGAYNLNWTTVQPVKEQIESALGIPFALDNDANVAALGERWKGAGE
2qm1A           -------------PGSVDIEKGTVVGAYNLNWTTVQPVKEQIESALGIPFALDNDANVAALGERWKGAGE
2hoeA           KLGSKLSALTVAAPGPIDTERGIIID-PRNFPLSQIPLANLLKEKYGIEVWVEND------ADGAVGEKW
1woqA           --------VGVTFPGII--QHGVVHSAANVDKSLNTDIDALLTARLGRPVEVINDADAAGLAEARYGAGA
2ap1A           ----------------------------------------------------------------------
2aa4A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSVLELTQL
3bp8B           GARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQL
3bp8A           GARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQL
1z6rA           GARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQL
1z05A           DVDNSVLISIHHGLGAGIVLDGRVLQGRHGNIGELGHIQIDPQGKRCHCGNYGCLETVASSQAIRDQVTA
3eo3A           GLENFVTLXXXXXXXXXXXHQHELIHGSSFCAAELGHLVVSLDGPDCSCGSHGCIEAYAS-GMALQREAK
3eo3C           GLENFVTLXXXXXXXXXXXHQHELIHGSSFCAAELGHLVVSLDGPDCSCGSHGCIEAYAS-GMALQREAK
3eo3B           GLENFVTLXXXXXXXXXXXHQHELIHGSSFCAAELGHLVVSLDGPDCSCGSHGCIEAYAS-GMALQREAK
2qm1B           NNPDVIFXXXXXXXXXXXXXXXXXLHGVAGCAGEVGHVTVDPNGFDCTCGKRGCLETVSSATGVVRVAR-
2qm1A           NNPDVIFXXXXXXXXXXXXXXXXXLHGVAGCAGEVGHVTVDPNGFDCTCGKRGCLETVSSATGVVRVAR-
2hoeA           YTKDSFAWXXXXXXXXXXXXXXXELYRGENGYAEIGYTRV-------FNGNYVFLEDVCNENVVLK----
1woqA           GVKGTVLVILGTGIGSAFIFDGKLV-----PNAELGHLEIDGHD----------AETKASA---------
2ap1A           --------------------------------------------RRCGCGQMGCIENYLSGRGFAWLYQH
2aa4A           ----------------------------------IGHTLADPHGPVCGCGRTGCVE--------------


                         .         *         .         .         .         .         +:350
query           RLNQSMSSMLHGQPLTVDSLCQAAMQGDLLAKDIISGVGTHVGRILAIMVNLFNPQKILIGSPLSKAADI
3bp8B           RLNQSMSSMLHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADI
3bp8A           RLNQSM----HGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADI
1z6rA           RLNQ--SSSLHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAI-VNLFNPQKILIGSPLSKAADI
1z05A           RIQAGEPSCLATEEISIEDICAAAADGDPLAVDVIQQLGRYLGAAIAIVINLFNPEKILIGGVINQAKSI
3eo3A           KLHDEDLLLVEGMSVPKDELIQAAKLGNAKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVLA-----
3eo3C           KLHDEDLLLVEGMSVPKEALIQAAKLGNAKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVLA-----
3eo3B           KLHDEDLLLVEGSAVGALHLIQAAKLGNAKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVLA-----
2qm1B           HLSEEFAAIDDGQDVSSKDVFEFAEKGDHFAL-VVDRVCFYXXXXXXXXXXXXXPDXXXXXXXXXXXXEF
2qm1A           HLSEEFAAIDDGQDVSSKDVFEFAEKGDHFAL-VVDRVCFYXXXXXXXXXXXXXPDXXXXXXXXXXXXEF
2hoeA           ------------HVLSGFSLAEARDSGDVRVKEYFDDIARYFSIGLLNLIHLFGISKIVIG---------
1woqA           ----------------------VARERDGLSWDEYSVL---LQRYFSHVEFLFSPELFIVGGGISKRADE
2ap1A           YYDQSLQA-----PEIIALWEQGDEQAHAHVERYLDLLAVCLGNILTIV----DPDLLVIGGGLSNFTAI
2aa4A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LFPAIADSIRQQALPAYSRNTVVESTQFTNQGTMAGAALVKDAMYNGSLLIRLLQG
3bp8B           LFPVISDSIRQQALPAYSQHISVESTQFSN---MAGAALVKDAMYNGSLLIRLLQG
3bp8A           LFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG
1z6rA           LFPVISDSIRQQALPAYSQHISVESTQFSNQGT-AGAALVKDA-YNGSLLIRLLQG
1z05A           LYPSIEQCIREQSLPVYHQDLKLVESRFYKQATMPGAALIKQALYDGLLLMKVVEG
3eo3A           --------------------------------------------------------
3eo3C           --------------------------------------------------------
3eo3B           --------------------------------------------------------
2qm1B           LRSRVEKYFQEFTFPQVRNSTKIKLAELGNEAGVIGAA------------------
2qm1A           LRSRVEKYFQEFTFPQVRNSTKIKLAELGNEAGVIGAA------------------
2hoeA           --------------------------------------------------------
1woqA           YLPNL--RLRTPIVPAVLRN------------------------------------
2ap1A           T-TQLAERLPRHLLPV-ARAPRIERARHGDAGGMRGAAFL----------------
2aa4A           --------------------------------------------------------