[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:nuoE

[Show Plain Result]

#ERROR : Can't open dsspfile "3iam2.bssp"
#ERROR : Can't open dsspfile "2fug2.bssp"
#ERROR : Can't open dsspfile "2auvA.bssp"

## Summary of PDB Search
:166
    9e-18  32%  3iam2  [x.x.x] NADH-QUINONE OXIDOREDUCTASE SUBUNIT 2
    9e-18  32%  2fug2  [x.x.x] NADH-QUINONE OXIDOREDUCTASE CHAIN 2
    1e-10  30%  2auvA  [x.x.x] POTENTIAL NAD-REDUCING HYDROGENASE SUBUNIT
:166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxKHHYEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVE
3iam2           -------------------------KYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVM
2fug2           -------------------------KYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVM
2auvA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKG
3iam2           GVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTA
2fug2           GVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTA
2auvA           ------------PKGKYPISVCMGTACFVKGADKVVHAFKEQLKIDIGDVTPDGRFSIDTLRCVGGCALA


                         +         .         .         .         .         *         .:210
query           PNMMIDEDTHSHLTPEAIPELLERYx
3iam2           PVIQVNDEPY----------------
2fug2           PVIQVNDEPY----------------
2auvA           PIVMVGEKVYGNVTPGQVKKILAEY-