[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:bioF

[Show Plain Result]

#ERROR : Can't open dsspfile "1bs0A.bssp"
#ERROR : Can't open dsspfile "1djeA.bssp"
#ERROR : Can't open dsspfile "3a2bA.bssp"
#ERROR : Can't open dsspfile "2w8wA.bssp"
#ERROR : Can't open dsspfile "2w8jA.bssp"
#ERROR : Can't open dsspfile "1fc4A.bssp"
#ERROR : Can't open dsspfile "2bwpB.bssp"
#ERROR : Can't open dsspfile "2bwpA.bssp"
#ERROR : Can't open dsspfile "2bwoD.bssp"
#ERROR : Can't open dsspfile "2bwoB.bssp"
#ERROR : Can't open dsspfile "2jgtA.bssp"
#ERROR : Can't open dsspfile "2bwoA.bssp"
#ERROR : Can't open dsspfile "2bwnE.bssp"
#ERROR : Can't open dsspfile "2bwnD.bssp"
#ERROR : Can't open dsspfile "2bwnB.bssp"
#ERROR : Can't open dsspfile "2bwnA.bssp"
#ERROR : Can't open dsspfile "2w8vA.bssp"
#ERROR : Can't open dsspfile "2w8uA.bssp"
#ERROR : Can't open dsspfile "2w8tA.bssp"
#ERROR : Can't open dsspfile "2jg2A.bssp"
#ERROR : Can't open dsspfile "2jgtB.bssp"
#ERROR : Can't open dsspfile "2wkaA.bssp"
#ERROR : Can't open dsspfile "2wk9A.bssp"
#ERROR : Can't open dsspfile "2wk8A.bssp"
#ERROR : Can't open dsspfile "2wk9B.bssp"
#ERROR : Can't open dsspfile "2wk8B.bssp"

## Summary of PDB Search
:385
    e-138  68%  1bs0A  [c.67.1] PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)
    e-136  68%  1djeA  [c.67.1] 8-AMINO-7-OXONANOATE SYNTHASE
    1e-42  31%  3a2bA  [x.x.x] SERINE PALMITOYLTRANSFERASE
    4e-40  29%  2w8wA  [x.x.x] SERINE PALMITOYLTRANSFERASE
    4e-40  29%  2w8jA  [x.x.x] SERINE PALMITOYLTRANSFERASE
    3e-38  33%  1fc4A  [c.67.1] 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE
    3e-37  32%  2bwpB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    3e-37  32%  2bwpA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    3e-37  32%  2bwoD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    3e-37  32%  2bwoB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    1e-36  30%  2jgtA  [x.x.x] SERINE PALMITOYLTRANSFERASE
    2e-35  31%  2bwoA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-35  31%  2bwnE  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-35  31%  2bwnD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-35  31%  2bwnB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-35  31%  2bwnA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    7e-35  28%  2w8vA  [x.x.x] SERINE PALMITOYLTRANSFERASE
    7e-35  28%  2w8uA  [x.x.x] SERINE PALMITOYLTRANSFERASE
    7e-35  28%  2w8tA  [x.x.x] SERINE PALMITOYLTRANSFERASE
    7e-35  28%  2jg2A  [x.x.x] SERINE PALMITOYLTRANSFERASE
    3e-34  29%  2jgtB  [x.x.x] SERINE PALMITOYLTRANSFERASE
    3e-29  26%  2wkaA  [x.x.x] CAI-1 AUTOINDUCER SYNTHASE
    3e-29  26%  2wk9A  [x.x.x] CAI-1 AUTOINDUCER SYNTHASE
    3e-29  26%  2wk8A  [x.x.x] CAI-1 AUTOINDUCER SYNTHASE
    2e-28  26%  2wk9B  [x.x.x] CAI-1 AUTOINDUCER SYNTHASE
    2e-28  27%  2wk8B  [x.x.x] CAI-1 AUTOINDUCER SYNTHASE
:385

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSWQQRVDDALTARRVTDTLRRRYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFX
1bs0A           -SWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFX
1djeA           -SWQEKINXXXXXXXXXXXXXXXYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFX
3a2bA           ------------------------------------DGRRVLMFGSNSYLGLTTDTRIIKAAQDALEKYG
2w8wA           ----------------------------------VIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFG
2w8jA           ----------------------------------VIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFG
1fc4A           --YQQLTNDLETARAEGLFKEERIITSAQQADITVADGSHVINFCANNYLGLANHPDLIAAAKAASVRFI
2bwpB           ----------------------------------------------NDYLGMGQHPVVLAAMHEALEAVG
2bwpA           ----------------------------------------------NDYLGMGQHPVVLAAMHEALEAVG
2bwoD           ----------------------------------------------NDYLGMGQHPVVLAAMHEALEAVG
2bwoB           ----------------------------------------------NDYLGMGQHPVVLAAMHEALEAVG
2jgtA           ----------------------------------VIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFG
2bwoA           ----------------------------------------------NDYLGMGQHPVVLAAMHEALEAVG
2bwnE           ----------------------------------------------NDYLGMGQHPVVLAAMHEALEAVG
2bwnD           ----------------------------------------------NDYLGMGQHPVVLAAMHEALEAVG
2bwnB           ----------------------------------------------NDYLGMGQHPVVLAAMHEALEAVG
2bwnA           ----------------------------------------------NDYLGMGQHPVVLAAMHEALEAVG
2w8vA           ----------------------------------VIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFG
2w8uA           ----------------------------------VIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFG
2w8tA           ----------------------------------VIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFG
2jg2A           ----------------------------------VIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFG
2jgtB           ----------------------------------VIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFG
2wkaA           ---------------------------------------------SNDYLALANHPLIKARLAKSLLEEQ
2wk9A           ---------------------------------------------SNDYLALANHPLIKARLAKSLLEEQ
2wk8A           ---------------------------------------------SNDYLALANHPLIKARLAKSLLEEQ
2wk9B           ---------------------------------------------SNDYLALANHPLIKARLAKSLLEMS
2wk8B           ---------------------------------------------SNDYLALANHPLIKARLAKSLLE--


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
1bs0A           XXXXXXXXXXXXXXXHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIAADRXXXXXXXXXX
1djeA           XXXXXXXXXXXXXXXHQALEEELAEWLGYSRALLFISGFXXXXXXXXXXXXKEDRIAADRXXXXXXXXXX
3a2bA           TGCAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDHASIIDGS
2w8wA           SGTYGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGC
2w8jA           SGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGC
1fc4A           CGTQD---------SHKELEQKLAAFLG-EDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGV
2bwpB           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLISDSLNHASMIEGI
2bwpA           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLISDSLNHASMIEGI
2bwoD           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLISDSLNHASMIEGI
2bwoB           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLISDSLNHASMIEGI
2jgtA           SGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLA--GEYVILDADSHASIYQGN
2bwoA           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLISDSLNHASMIEGI
2bwnE           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLISDSLNHASMIEGI
2bwnD           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLISDSLNHASMIEGI
2bwnB           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLISDSLNHASMIEGI
2bwnA           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLISDSLNHASMIEGI
2w8vA           SGTWGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGC
2w8uA           SGTYGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGC
2w8tA           SGTCGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGC
2jg2A           SGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGC
2jgtB           SGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLA--GEYVILD----------A
2wkaA           QSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGA
2wk9A           QSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGA
2wk8A           QSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGA
2wk9B           ASFLQNDYDKPM------IEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGA
2wk8B           ------------------IEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGA


                         +         .         .         .         .         *         .:210
query           NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
1bs0A           XXXXXXXRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
1djeA           XXXXXXXRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
3a2bA           RLSFSKVIKYGHNNMEDLAKLSRLPEDSAKLICTDGIFSMEGDIVNLPELTSIANEFDAAVMVDDAHSLG
2w8wA           QQGNAEIVRFRHNSVEDLDRLGRLPKEPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMG
2w8jA           QQGNAEIVRFRHNSVEDLDRLGRLPKEPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMG
1fc4A           RLCKAKRYRYANNDXXXXXXXXXXXXXXHVLIATDGVFS-DGVIANLKGVCDLADKYDA-LVVDDSHAVG
2bwpB           KRNAGPKRIFRHNDVAHLRELIAADDAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2bwpA           KRNAGPKRIFRHNDVAHLRELIAADDAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2bwoD           KRNAGPKRIFRHNDVAHLRELIAADDAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2bwoB           KRNAGPKRIFRHNDVAHLRELIAADDAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2jgtA           ----AEIVRFRHNSVEDLDRLGRLPKEPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMG
2bwoA           KRNAGPKRIFRHNDVAHLRELIAADDAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2bwnE           KRNAGPKRIFRHNDVAHLRELIAADDAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2bwnD           KRNAGPKRIFRHNDVAHLRELIAADDAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2bwnB           KRNAGPKRIFRHNDVAHLRELIAADDAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2bwnA           KRNAGPKRIFRHNDVAHLRELIAADDAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2w8vA           QQGNAEIVRFRHNSVEDLDRLGRLPKEPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMG
2w8uA           QQGNAEIVRFRHNSVEDLDRLGRLPKEPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMG
2w8tA           QQGNAEIVRFRHNSVEDLDRLGRLPKEPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMG
2jg2A           QQGNAEIVRFRHNSVEDLDRLGRLPKEPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMG
2jgtB           DSGNAEIVRFRHNSVEDLDRLGRLPKEPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMG
2wkaA           RYANAQAHPFMHNNCDHLRMLIQRH--GPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLG
2wk9A           RYANAQAHPFMHNNCDHLRMLIQRH--GPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLG
2wk8A           RYANAQAHPFMHNNCDHLRMLIQRH--GPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLG
2wk9B           RYANAQAHPFMHNNCDHLRMLIQRH--GPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLG
2wk8B           RYANAQAHPFMHNNCDHLRMLIQRH--GPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLG


                         .         .         .         +         .         .         .:280
query           VTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXXXXXXXXXX
1bs0A           VIGEQGRGSCWLQKVKPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASL
1djeA           VIGEQGRGSCWLQKVKPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASL
3a2bA           VIGHKGAGTASHFGLNDDLIMGTFSKSLASLGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKAL
2w8wA           FFGPNGRGVYEAQGLEGQIVVGTFSKSVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSI
2w8jA           FFGPNGRGVYEAQGLEGQIVVGTFSKSVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSI
1fc4A           FVGENGRGSHEYCDVRVDIITGTLGKALGASGGYTAARKEVVEWLRQRSRPYLFSNSL---APAIVAASI
2bwpB           MYGPRGAGVAERDGLRIDIFNGTLAKAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPXXXXXXXXXX
2bwpA           MYGPRGAGVAERDGLRIDIFNGTLAKAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPXXXXXXXXXX
2bwoD           MYGPRGAGVAERDGLRIDIFNGTLAKAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPXXXXXXXXXX
2bwoB           MYGPRGAGVAERDGLRIDIFNGTLAKAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPXXXXXXXXXX
2jgtA           FFGPNGRGVYEAQGLEGQIVVGTFSKSVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSI
2bwoA           MYGPRGAGVAERDGLMHRIDIFNGTAAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPXXXXXXXXXX
2bwnE           MYGPRGAGVAERDGLMHRIDIFNGTAAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPXXXXXXXXXX
2bwnD           MYGPRGAGVAERDGLMHRIDIFNGTAAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPXXXXXXXXXX
2bwnB           MYGPRGAGVAERDGLMHRIDIFNGTAAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPXXXXXXXXXX
2bwnA           MYGPRGAGVAERDGLMHRIDIFNGTAAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPXXXXXXXXXX
2w8vA           FFGPNGRGVYEAQGLEGQIDXXXXXXXXXXXXXXXXXXNHPKFEAVRLARPYIFTASLPPSVVATATTSI
2w8uA           FFGPNGRGVYEAQGLEGQIDXXXXXXXXXXXXXXXXXXNHPKFEAVRLARPYIFTASLPPSVVATATTSI
2w8tA           FFGPNGRGVYEAQGLEGQIDXXXXXXXXXXXXXXXXXXNHPKFEAVRLARPYIFTASLPPSVVATATTSI
2jg2A           FFGPNGRGVYEAQGLEGQIDXXXXXXXXXXXXXXXXXXNHPKFEAVRLARPYIFTASLPPSVVATATTSI
2jgtB           FFGPNGRGVYEAQGLEGQIVVGTFSKSVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSI
2wkaA           THGPNGAGLLAELGLTREVMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTL
2wk9A           THGPNGAGLLAELGLTREVMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTL
2wk8A           THGPNGAGLLAELGLTREVMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTL
2wk9B           THGPNGAGLLAELGLTREVMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTL
2wk8B           THGPNGAGLLAELGLTREVMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTL


                         .         *         .         .         .         .         +:350
query           XVIRSDEGGERREKLAALVQRFRAGVNASRFTLLNAHSAIQPLIVGDNSRALRLAEALRQQGCWATAIRP
1bs0A           AVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRP
1djeA           AVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTGIRP
3a2bA           EIIQNEP--EHIEKLWKNTDYAKAQLLDHGFDLGATESPILPIFIRSNEKTFWVTKMLQDDGVFVNPVVS
2w8wA           RKLMT--AHEKRERLWSNARALHGGLKAMGFRLETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARP
2w8jA           RKLMT--AHEKRERLWSNARALHGGLKAMGFRLETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARP
1fc4A           KVLEVEAGSELRDRLWANARQFRE-QSAAGFTLAGADHAIIP-VLGDAVVAQKFARELQKEGIYVTGFFY
2bwpB           XFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAVSDLLSDYGVYVQPINF
2bwpA           XFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAVSDLLSDYGVYVQPINF
2bwoD           XFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAVSDLLSDYGVYVQPINF
2bwoB           XFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAVSDLLSDYGVYVQPINF
2jgtA           RKLMT--AHEKRERLWSNARALHGGLKAMGFRLETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARP
2bwoA           XFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAVSDLLSDYGVYVQPINF
2bwnE           XFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAVSDLLSDYGVYVQPINF
2bwnD           XFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAVSDLLSDYGVYVQPINF
2bwnB           XFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAVSDLLSDYGVYVQPINF
2bwnA           XFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAVSDLLSDYGVYVQPINF
2w8vA           RKLMT--AHEKRERLWSNARALHGGLKAMGFRLETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARP
2w8uA           RKLMT--AHEKRERLWSNARALHGGLKAMGFRLETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARP
2w8tA           RKLMT--AHEKRERLWSNARALHGGLKAMGFRLETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARP
2jg2A           RKLMT--AHEKRERLWSNARALHGGLKAMGFRLETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARP
2jgtB           RKLMT--AHEKRERLWSNARALHGGLKAMGFRLETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARP
2wkaA           EIIESAD--NRRQHLDRMARKLRIGLSQLGLT-IRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCR
2wk9A           EIIESAD--NRRQHLDRMARKLRIGLSQLGLT-IRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCR
2wk8A           EIIESAD--NRRQHLDRMARKLRIGLSQLGLT-IRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCR
2wk9B           EIIESAD--NRRQHLDRMARKLRIGLSQLGLT-IRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCR
2wk8B           EIIESAD--NRRQHLDRMARKLRIGLSQLGLT-IRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCR


                         .         .         .         .         *         .         .:420
query           PTVPVGTARLRLTLTQAHEACDIDRLLEVLHGAGE
1bs0A           PTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGNG-
1djeA           PTVPAGIARLRLTLTAAHEMQDIDRLLEVLHGNG-
3a2bA           PAVPAEESLIRFSLMATHTYDQIDEAIE-------
2w8wA           PATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAG-
2w8jA           PATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAG-
1fc4A           PVVPKGQARIR-TQSAAHTPEQITRAVEAFTRIGK
2bwpB           PTVPRGTERLRFTPSPVHDLKQIDGLVHAM-----
2bwpA           PTVPRGTERLRFTPSPVHDLKQIDGLVHAM-----
2bwoD           PTVPRGTERLRFTPSPVHDLKQIDGLVHAM-----
2bwoB           PTVPRGTERLRFTPSPVHDLKQIDGLVHAM-----
2jgtA           PATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAG-
2bwoA           PTVPRGTERLRFTPSPVHDLKQIDGLVHAM-----
2bwnE           PTVPRGTERLRFTPSPVHDLKQIDGLVHAM-----
2bwnD           PTVPRGTERLRFTPSPVHDLKQIDGLVHAM-----
2bwnB           PTVPRGTERLRFTPSPVHDLKQIDGLVHAM-----
2bwnA           PTVPRGTERLRFTPSPVHDLKQIDGLVHAM-----
2w8vA           PATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAG-
2w8uA           PATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAG-
2w8tA           PATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAG-
2jg2A           PATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAG-
2jgtB           PATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAG-
2wkaA           PATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDA--
2wk9A           PATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDA--
2wk8A           PATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDA--
2wk9B           PATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDA--
2wk8B           PATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDA--