[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF68197.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1s7nB.bssp"
#ERROR : Can't open dsspfile "1s7lA.bssp"
#ERROR : Can't open dsspfile "1s7nA.bssp"
#ERROR : Can't open dsspfile "1z9uB.bssp"
#ERROR : Can't open dsspfile "1s7nC.bssp"
#ERROR : Can't open dsspfile "1s7fA.bssp"
#ERROR : Can't open dsspfile "1z9uA.bssp"
#ERROR : Can't open dsspfile "1s7kA.bssp"
#ERROR : Can't open dsspfile "1nslC.bssp"
#ERROR : Can't open dsspfile "1nslF.bssp"
#ERROR : Can't open dsspfile "1nslA.bssp"
#ERROR : Can't open dsspfile "1nslE.bssp"
#ERROR : Can't open dsspfile "2fckA.bssp"
#ERROR : Can't open dsspfile "2vi7C.bssp"
#ERROR : Can't open dsspfile "2vi7B.bssp"
#ERROR : Can't open dsspfile "2vi7A.bssp"
#ERROR : Can't open dsspfile "3igrA.bssp"
#ERROR : Can't open dsspfile "2ae6A.bssp"
#ERROR : Can't open dsspfile "2i79E.bssp"
#ERROR : Can't open dsspfile "2i79A.bssp"
#ERROR : Can't open dsspfile "3eg7F.bssp"
#ERROR : Can't open dsspfile "3eg7E.bssp"
#ERROR : Can't open dsspfile "3eg7C.bssp"
#ERROR : Can't open dsspfile "3eg7B.bssp"
#ERROR : Can't open dsspfile "3eg7A.bssp"

## Summary of PDB Search
:179
    e-103  98%  1s7nB  [x.x.x] ACETYL TRANSFERASE
    e-102  98%  1s7lA  [x.x.x] ACETYL TRANSFERASE
    e-102  98%  1s7nA  [x.x.x] ACETYL TRANSFERASE
    e-101  98%  1z9uB  [x.x.x] ACETYL TRANSFERASE
    e-101  98%  1s7nC  [x.x.x] ACETYL TRANSFERASE
    8e-98  98%  1s7fA  [x.x.x] ACETYL TRANSFERASE
    2e-95  98%  1z9uA  [x.x.x] ACETYL TRANSFERASE
    2e-86  98%  1s7kA  [x.x.x] ACETYL TRANSFERASE
    2e-12  27%  1nslC  [d.108.1] PROBABLE ACETYLTRANSFERASE
    4e-12  26%  1nslF  [d.108.1] PROBABLE ACETYLTRANSFERASE
    1e-11  28%  1nslA  [d.108.1] PROBABLE ACETYLTRANSFERASE
    1e-11  33%  1nslE  [d.108.1] PROBABLE ACETYLTRANSFERASE
    3e-07  29%  2fckA  [x.x.x] RIBOSOMAL-PROTEIN-SERINE ACETYLTRANSFERASE,
    2e-05  26%  2vi7C  [x.x.x] ACETYLTRANSFERASE PA1377
    4e-05  26%  2vi7B  [x.x.x] ACETYLTRANSFERASE PA1377
    4e-05  26%  2vi7A  [x.x.x] ACETYLTRANSFERASE PA1377
    4e-04  32%  3igrA  [x.x.x] RIBOSOMAL-PROTEIN-S5-ALANINE N-ACETYLTRANSFERASE
    4e-04  27%  2ae6A  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    8e-04  26%  2i79E  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    8e-04  26%  2i79A  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    8e-04  18%  3eg7F  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    8e-04  18%  3eg7E  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    8e-04  18%  3eg7C  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    8e-04  18%  3eg7B  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    8e-04  18%  3eg7A  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
:179

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPQYVTSQEETRKHVQGNMLLHQRGYAKMY
1s7nB           MVEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPQYVTSQEETRKHVQGNILLHQRGYAKMY
1s7lA           --EIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPQYVTSQEETRKHVQGNILLHQRGYAKMY
1s7nA           -VEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPQYVTSQEETRKHVQGNILLHQRGYAKMY
1z9uB           -VEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPQYVTSQEETRKHVQGNILLHQRGYAKMY
1s7nC           --EIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPQYVTSQEETRKHVQGNILLHQRGYAKMY
1s7fA           MVEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWP---TSQEETRKHVQGNILLHQRGYAKMY
1z9uA           --EIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLD--QY-TSQEETRKHVQGNILLHQRGYAKMY
1s7kA           --EIIPVSTTLELRAADESHVPALHQLVLKN-------------------TRKHVQGNILLHQRGYAKMY
1nslC           ------VNEHITIRLLEPKDAERLAELIIQNQQRLGKWLFFAENPSSADTYRETIIPDW---RRQYADLN
1nslF           ------VNEHITIRLLEPKDAERLAELIIQNQQRLGKWLFFPSSADTYRETIIPDWRRQYADLNGIEAGL
1nslA           ------VNEHITIRLLEPKDAERLAELIIQN----QQRLGKWLFFSSADTYRETIIPDW---RRQYADLN
1nslE           ----------------------------------------------------------------------
2fckA           ------VTQRLQLRLITADEAEELVQCIRQSQT-LHQWVDW----FSQQEAEQFIQATRLNWVKAEAYGF
2vi7C           -------SPTIRLERYSERHVEGLTALY-NDPAVARQVLQMPYQSVEQRRKRLHDSDDDRL------LIL
2vi7B           ---------TIRLERYSERHVEGLTALY-NDPAVARQVLQMPYQSVEQRRKRLHDSDDDRL------LIL
2vi7A           ---------TIRLERYSERHVEGLTALY-NDPAVARQVLQMPYQSVEQRRKRLHDSDDDRL------LIL
3igrA           ------------------------------------------------------------LHKHNLAFYF
2ae6A           -------STSLTIRLVAEADWPALHAL--------DQIISLAAYQEKKDET-----------------IF
2i79E           ----------------------------------------------------------------------
2i79A           ----------------------------------------------------------------------
3eg7F           -------NSQLTLRALERGDLRFIHNLNNNRNIWFEEPYE--SFDELEELYNKHI------HDNAERRFV
3eg7E           -------NSQLTLRALERGDLRFIHNLNNNRNIWFEEPYE--SFDELEELYNKHI------HDNAERRFV
3eg7C           -------NSQLTLRALERGDLRFIHNLNNNRNIWFEEPYE--SFDELEELYNKHI------HDNAERRFV
3eg7B           -------NSQLTLRALERGDLRFIHNLNNNRNIWFEEPYE--SFDELEELYNKHI------HDNAERRFV
3eg7A           -------NSQLTLRALERGDLRFIHNLNNNRNIWFEEPYE--SFDELEELYNKHI------HDNAERRFV


                         .         .         *         .         .         .         .:140
query           LIFCQNEMAGVLSFNAIEPVNKAAYIGYWLDESLQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQA
1s7nB           LIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQA
1s7lA           LIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQA
1s7nA           LIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQA
1z9uB           LIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQA
1s7nC           LIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQA
1s7fA           LIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQA
1z9uA           LIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQA
1s7kA           LIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQA
1nslC           GILYDGSLCGI-SLHNLDQVNRKAEIGYWIAKEFEGKGIITAACRKLITYAFEELELNRVAICAAVGNEK
1nslF           LY--DGSLCGI-SLHNLDQVNRKAEIGYWIAKEFEGKGIITAACRKLITYAFEELELNRVAICAAVGNEK
1nslA           GILYDGSLCGI-SLHNLDQVNRKAEIGYWIAKEFEGKGIITAACRKLITYAFEELELNRVAICAAVGNEK
1nslE           -----------ISLHNLDQVNRKAEIGYWIAKEFEGKGIITAACRKLITYAFEELELNRVAICAAVGNEK
2fckA           GVFERQTLVGVAINEFYHTFN--ASLGYWIGDRYQRQGYGKEALTALILFCFERLELTRLEIVCDPENVP
2vi7C           VALHQGDVIGSASLEQHPRIRRSGSIGMGVAVAWQGKGVGSRLLGELLDIADNWMNLRRVELTVYTDNAP
2vi7B           VALHQGDVIGSASLEQHPRIRRSGSIGMGVAVAWQGKGVGSRLLGELLDIADNWMNLRRVELTVYTDNAP
2vi7A           VALHQGDVIGSASLEQHPRIRRSGSIGMGVAVAWQGKGVGSRLLGELLDIADNWMNLRRVELTVYTDNAP
3igrA           VVVDKNEIIGTVSYSNITRFPHAGHVGYSLDSEYQGKGIKAQNLHRIAAYIPR--------------NEK
2ae6A           VAISGQQLAGFIEVHP--PTSLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDAEISGIKLSLRVTNQE
2i79E           LAFLNGKIAGIVNITA-DQRKRVRHIGYW------NNGLGSLLLEEAIEWAQASGILRRLQLTVQTRNQA
2i79A           LAFLNGKIAGIVNITA-DQRKRVRHIGYW------NNGLGSLLLEEAIEWAQASGILRRLQLTVQTRNQA
3eg7F           VEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPK
3eg7E           VEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPK
3eg7C           VEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPK
3eg7B           VEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPK
3eg7A           VEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPK


                         +         .         .         .         .         *         .:210
query           SNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDAD
1s7nB           SNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDAD
1s7lA           SNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDAD
1s7nA           SNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDA-
1z9uB           SNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIID--
1s7nC           SNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDA-
1s7fA           SNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARII---
1z9uA           SNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIID--
1s7kA           SNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDAD
1nslC           SRAVPERIGFLEEGKARDGLYVNG-HHDLVYYS------
1nslF           SRAVPERIGFLEEGKARDGLYVNG-HHDLVYYS------
1nslA           SRAVPERIGFLEEGKARDGLYVNG-HHDLVYYS------
1nslE           SRAVPERIGFLEEGKARDGLYVNG-HHDLVYYS------
2fckA           SQALALR--------------------------------
2vi7C           ALALYRKFGFETEGEMRDYAVRDGRFVDVYSMARL----
2vi7B           ALALYRKFGFETEGEMRDYAVRDGRFVDVYSMARL----
2vi7A           ALALYRKFGFETEGEMRDYAVRDGRFVDVYSMARL----
3igrA           SAKVLAALGFVKEGEAKKYLYINGAWEDHILTSKIND--
2ae6A           AIRFYEKHGFVQEAHFKEEFYINGHYCDDYQYAYFI---
2i79E           AVHLYQKHGFVIEGSQERGAYIEGKFIDVYLMGKLI---
2i79A           AVHLYQKHGFVIEGSQERGAYIEGKFIDVYLMGKLI---
3eg7F           AVHLYEECGFVEEGHLVEEFFINGRYQDVKRY-------
3eg7E           AVHLYEECGFVEEGHLVEEFFINGRYQDVKRY-------
3eg7C           AVHLYEECGFVEEGHLVEEFFINGRYQDVKRY-------
3eg7B           AVHLYEECGFVEEGHLVEEFFINGRYQDVKRY-------
3eg7A           AVHLYEECGFVEEGHLVEEFFINGRYQDVKRY-------