[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF68340.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2jmrA.bssp"
#ERROR : Can't open dsspfile "3bwuF.bssp"
#ERROR : Can't open dsspfile "3bfqG.bssp"
#ERROR : Can't open dsspfile "1pdkB.bssp"
#ERROR : Can't open dsspfile "2uy7D.bssp"
#ERROR : Can't open dsspfile "2uy7B.bssp"
#ERROR : Can't open dsspfile "1ze3H.bssp"
#ERROR : Can't open dsspfile "1klfB.bssp"
#ERROR : Can't open dsspfile "1kiuB.bssp"

## Summary of PDB Search
:172
    8e-25  41%  2jmrA  [x.x.x] FIMF
    2e-19  46%  3bwuF  [x.x.x] PROTEIN FIMF
    2e-10  32%  3bfqG  [x.x.x] PROTEIN FIMG
    1e-08  31%  1pdkB  [b.2.3] PROTEIN (PROTEIN PAPK)
    4e-08  30%  2uy7D  [x.x.x] PAP FIMBRIAL MAJOR PILIN PROTEIN
    7e-08  30%  2uy7B  [x.x.x] PAP FIMBRIAL MAJOR PILIN PROTEIN
    7e-05  36%  1ze3H  [x.x.x] FIMH PROTEIN
    7e-05  36%  1klfB  [b.2.3 - b.2.3] FIMH PROTEIN
    7e-05  36%  1kiuB  [b.2.3 - b.2.3] FIMH PROTEIN
:172

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxDGRVYVSGTITDNTCSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFA
2jmrA           ---------------------DSTITIRGYVRDNGCSVAAESTNFTVDLMENAAKQFNNIGATTPVVPFR
3bwuF           --------------------------------DNGCSVAAESTNFIGATTPVV--------------PFR
3bfqG           -----------------------------------CTVS--TTNATVDLGDLYSFSLMSAGAASAWHDVA
1pdkB           ------------------------------LLDRPCHVSGDSLNKHVVFKTRASRDFWYPPGRSPTESFV
2uy7D           ----------------------GKVTFNNTVVDAPCSISQKSADQSIDFGQLS-KSFLEAGGVSKPMDLD
2uy7B           ----------------------GKVTFNNTVVDAPCSISQKSADQSIDFGQLS-KSFLEAGGVSKPMDLD
1ze3H           ----------------------------------------------------------------------
1klfB           ----------------------------------------------------------------------
1kiuB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IDLQNCGSTASGVTVSFSGAADSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQAS
2jmrA           ILLSPCGNAVSAVKVGFTGVADSHNANLLALENTVSAASGLGIQLLNEQQNQIPLNAPSSALTLTPGKPN
3bwuF           ILLSPCGNAVSAVKVGFTGVADSHNANLLALENTVSAASGLGIQLLNEQQNQIPLNAPSSALTLTPGKPN
3bfqG           LELTNCPVGTSRVTASFSGAADS-----TGYYKNQGTAQNIQLELQDDSGNTLNTG-ATKTVQVDDSSQS
1pdkB           IRLENCHATAVGVTLTFKGTEEAALPGHLKVTGVNAGRLGIALLDTDGSSLLKPGTSHNKGQGEKVTGNS
2uy7D           IELVNCDITAGTVKLAFTGPIVNGHSDELDTNGG----TGTAIVVQGAGKNVVFDGSEGDANTLKDGENV
2uy7B           IELVNCDITAGTVKLAFTGPIVNGHSDELDTNGG----TGTAIVVQGAGKNVVFDGSEGDANTLKDGENV
1ze3H           ---QNLGYYLSGTT------ADAGNS-IFTNTASFSPAQGVGVQL-TRNGTIIPA---NNTVSLGAGTSA
1klfB           ---QNLGYYLSGTT------ADAGNS-IFTNTASFSPAQGVGVQL-TRNGTIIPA---NNTVSLGAGTSA
1kiuB           ---QNLGYYLSGTT------ADAGNS-IFTNTASFSPAQGVGVQL-TRNGTIIPA---NNTVSLGAGTSA


                         +         .         .         .         .         *         .:210
query           AHLQFYARYLADGGAVTPGDANASATFILAYE
2jmrA           T-LNFYARLMATQVPVTAGHINATATFTLEYQ
3bwuF           T-LNFYARLMATQVPVTAGHINATATFTLEYQ
3bfqG           AHFPLQVRALTVNGGATQGTIQAVISITYTY-
1pdkB           LELPFGAYVVATPEAVVPGDYEATATFELTY-
2uy7D           LHTXXXXXXXXXXXXXTEGAFSAVANFNLTYQ
2uy7B           LHTXXXXXXXXXXXXXTEGAFSAVANFNLTYQ
1ze3H           VSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
1klfB           VSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
1kiuB           VSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ