[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:panE.2

[Show Plain Result]

#ERROR : Can't open dsspfile "2ew2A.bssp"
#ERROR : Can't open dsspfile "2ew2B.bssp"
#ERROR : Can't open dsspfile "3hwrB.bssp"
#ERROR : Can't open dsspfile "3hwrA.bssp"
#ERROR : Can't open dsspfile "1yonA.bssp"
#ERROR : Can't open dsspfile "1yjqA.bssp"
#ERROR : Can't open dsspfile "2ofpB.bssp"
#ERROR : Can't open dsspfile "2ofpA.bssp"
#ERROR : Can't open dsspfile "1ks9A.bssp"
#ERROR : Can't open dsspfile "3hn2D.bssp"
#ERROR : Can't open dsspfile "3hn2B.bssp"
#ERROR : Can't open dsspfile "3hn2A.bssp"
#ERROR : Can't open dsspfile "3i83A.bssp"
#ERROR : Can't open dsspfile "3i83B.bssp"
#ERROR : Can't open dsspfile "3egoB.bssp"
#ERROR : Can't open dsspfile "3egoA.bssp"
#ERROR : Can't open dsspfile "3ghyB.bssp"
#ERROR : Can't open dsspfile "3ghyA.bssp"
#ERROR : Can't open dsspfile "3g17G.bssp"
#ERROR : Can't open dsspfile "3g17E.bssp"
#ERROR : Can't open dsspfile "3g17D.bssp"
#ERROR : Can't open dsspfile "3g17C.bssp"
#ERROR : Can't open dsspfile "3g17A.bssp"
#ERROR : Can't open dsspfile "3g17F.bssp"

## Summary of PDB Search
:305
    2e-53  41%  2ew2A  [x.x.x] 2-DEHYDROPANTOATE 2-REDUCTASE, PUTATIVE
    6e-53  41%  2ew2B  [x.x.x] 2-DEHYDROPANTOATE 2-REDUCTASE, PUTATIVE
    3e-18  27%  3hwrB  [x.x.x] 2-DEHYDROPANTOATE 2-REDUCTASE
    3e-18  27%  3hwrA  [x.x.x] 2-DEHYDROPANTOATE 2-REDUCTASE
    8e-18  28%  1yonA  [x.x.x] 2-DEHYDROPANTOATE 2-REDUCTASE
    8e-18  28%  1yjqA  [x.x.x] 2-DEHYDROPANTOATE 2-REDUCTASE
    8e-18  28%  2ofpB  [x.x.x] KETOPANTOATE REDUCTASE
    8e-18  28%  2ofpA  [x.x.x] KETOPANTOATE REDUCTASE
    8e-18  28%  1ks9A  [c.2.1 - a.100.1] 2-DEHYDROPANTOATE 2-REDUCTASE
    1e-17  26%  3hn2D  [x.x.x] 2-DEHYDROPANTOATE 2-REDUCTASE
    1e-17  26%  3hn2B  [x.x.x] 2-DEHYDROPANTOATE 2-REDUCTASE
    1e-17  26%  3hn2A  [x.x.x] 2-DEHYDROPANTOATE 2-REDUCTASE
    2e-11  21%  3i83A  [x.x.x] 2-DEHYDROPANTOATE 2-REDUCTASE
    1e-09  24%  3i83B  [x.x.x] 2-DEHYDROPANTOATE 2-REDUCTASE
    7e-09  23%  3egoB  [x.x.x] PROBABLE 2-DEHYDROPANTOATE 2-REDUCTASE
    7e-09  23%  3egoA  [x.x.x] PROBABLE 2-DEHYDROPANTOATE 2-REDUCTASE
    1e-08  25%  3ghyB  [x.x.x] KETOPANTOATE REDUCTASE PROTEIN
    6e-08  25%  3ghyA  [x.x.x] KETOPANTOATE REDUCTASE PROTEIN
    3e-07  23%  3g17G  [x.x.x] SIMILAR TO 2-DEHYDROPANTOATE 2-REDUCTASE
    3e-07  23%  3g17E  [x.x.x] SIMILAR TO 2-DEHYDROPANTOATE 2-REDUCTASE
    3e-07  23%  3g17D  [x.x.x] SIMILAR TO 2-DEHYDROPANTOATE 2-REDUCTASE
    3e-07  23%  3g17C  [x.x.x] SIMILAR TO 2-DEHYDROPANTOATE 2-REDUCTASE
    3e-07  23%  3g17A  [x.x.x] SIMILAR TO 2-DEHYDROPANTOATE 2-REDUCTASE
    4e-04  21%  3g17F  [x.x.x] SIMILAR TO 2-DEHYDROPANTOATE 2-REDUCTASE
:305

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxMGCRFGYMLLEAGHDVTLIDGWQEHVDAIRSKGLFVETETTQKYYPIPAMLADESQGEFE
2ew2A           -----------GSRLG-ILHQGGNDVTLIDQWPAHIEAIRKNGLIADFNGEEVVANLPIFSPEEQNEQVD
2ew2B           -----------------ILHQGGNDVTLIDQWPAHIEAIRKNGLIADFNGEEVVANLPIFSPEEQNEQVD
3hwrB           ----------VGCYYGG-LARAGHEVILI-ARPQHVQAIEATGLRLETQSFDEQVKVSAS-SDPSAVQGA
3hwrA           ----------VGCYYGG-LARAGHEVILI-ARPQHVQAIEATGLRLETQSFDEQVKVSAS-SDPSAVQGA
1yonA           ---------------------------------------------------------------------D
1yjqA           ---------------------------------------------------------------------D
2ofpB           ---------------------------------------------------------------------D
2ofpA           ---------------------------------------------------------------------D
1ks9A           ---------------------------------------------------------------------D
3hn2D           ---------------------SGEDVHFL--LRRDYEAIAGNGLKVFSINGDFTLPVKGYRAPEEIGPMD
3hn2B           ---------------------SGEDVHFL--LRRDYEAIAGNGLKVFSINGDFTLPVKGYRAPEEIGPMD
3hn2A           ---------------------SGEDVHFL--LRRDYEAIAGNGLKVFSINGDFTLPVKGYRAPEEIGPMD
3i83A           ----------IGSFYGALLAKTGHCVSVVS--RSDYETVKAKGIRIRSATLGDYTFRPAAVAAELETKPD
3i83B           ----------IGSFYGALLAKTGHCVSVVS--RSDYETVKAKGIRIRSATLGDYTFRPAAVVRDCT----
3egoB           -----------------------HDVTVVTRRQEQAAAIQSEGIRLYKGGEEFRADCSADTSINS--DFD
3egoA           -----------------------HDVTVVTRRQEQAAAIQSEGIRLYKGGEEFRADCSADTSINS--DFD
3ghyB           -----------------------------------LQALQTAGLRLTEDGATHTLPVRATHDAAALGEQD
3ghyA           -----------------------------------LQALQTAGLRLTEDGATHTLPVRATHDAAALGEQD
3g17G           --------------------------------------------------TITYYTVPHAPAEDVTNTFD
3g17E           --------------------------------------------------TITYYTVPHAPAEDVTNTFD
3g17D           --------------------------------------------------TITYYTVPHAPAEDVTNTFD
3g17C           --------------------------------------------------TITYYTVPHAPAEDVTNTFD
3g17A           --------------------------------------------------TITYYTVPHAPAEDVTNTFD
3g17F           --------------------------------------------------TITYYTVPHAPAEDVTNTFD


                         .         .         *         .         .         .         .:140
query           LVILFTKAMQLDSMLQRIKPLLPAAKVVMILSNGLGNIETLEKYVDRQKIYAGVTLWSSELEGAGHIMAT
2ew2A           LIIALTKAQQLDAF-KAIQPITEKTYVLCLL-NGLGHEDVLEKYVPKENILVGIT-WTAGLEGPGRVKLL
2ew2B           LIIALTKAQQLDAF-KAIQPITEKTYVLCLL-NGLGHEDVLEKYVPKENILVGIT-WTAGLEGPGRVKLL
3hwrB           DLVLFCVKSTDTQXXXXXXXXXXXXXXXXXXQNGVENADTLRSLLEQEXXXXXXXXXTEA--GPGHVRHH
3hwrA           DLVLFCVKSTDTQXXXXXXXXXXXXXXXXXXQNGVENADTLRSLLEQEXXXXXXXXXTEA--GPGHVRHH
1yonA           LLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIEELQNI--QQPLLMGTTTHAARRDG-NVIIHV
1yjqA           LLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIEELQNI--QQPLLMGTTTHAARRDG-NVIIHV
2ofpB           LLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIEELQNI--QQPLLMGTTTHAARRDG-NVIIHV
2ofpA           LLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIEELQNI--QQPLLMGTTTHAARRDG-NVIIHV
1ks9A           LLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIEELQNI--QQPLLMGTTTHAARRDG-NVIIHV
3hn2D           LVLVGLKTFANSRYEELIRPLVEEGTQILTLQNGLGNEEALATLFGAERIIGGVAFLCSNRGEPGEVHHL
3hn2B           LVLVGLKTFANSRYEELIRPLVEEGTQILTLQNGLGNEEALATLFGAERIIGGVAFLCSNRGEPGEVHHL
3hn2A           LVLVGLKTFANSRYEELIRPLVEEGTQILTLQNGLGNEEALATLFGAERIIGGVAFLCSNRGEPGEVHHL
3i83A           CTLLCIKVVEGADRVGLLRDAVAPDTGIVLISNGIDIEPEVAAAFPDNEVISGLAFIGVTRTAPGEIWHQ
3i83B           ------------LLCDRVGLLRDAVAGIVLISNGI-DIEP-EVAAAFPEVISGLAFIGVTRTAPGEIWHQ
3egoB           LLVVTVKQHQLQSVFSSLERI--GKTNILFLQNGMGHIHDLKDWHVGHSIYVGIVEHGAVRKSDTAVDHT
3egoA           LLVVTVKQHQLQSVFSSLERI--GKTNILFLQNGMGHIHDLKDWHVGHSIYVGIVEHGAVRKSDTAVDHT
3ghyB           VVIVAVKAPALESVAAGIAPLIGPGTCVVVAMNGVGPLQRIAQAIPTRHVLGCVVHLTCATVSPGHIRHG
3ghyA           VVIVAVKAPALESVAAGIAPLIGPGTCVVVAMNGVGPLQRIAQAIPTRHVLGCVVHLTCATVSPGHIRHG
3g17G           VIIIAVKTHQLDAVIPHLTYLAHEDTLIILAQNGYGQLE----HIPFKNVCQAVVYISGQKKGD---VVT
3g17E           VIIIAVKTHQLDAVIPHLTYLAHEDTLIILAQNGYGQLE----HIPFKNVCQAVVYISGQKKGD---VVT
3g17D           VIIIAVKTHQLDAVIPHLTYLAHEDTLIILAQNGYGQLE----HIPFKNVCQAVVYISGQKKGD---VVT
3g17C           VIIIAVKTHQLDAVIPHLTYLAHEDTLIILAQNGYGQLE----HIPFKNVCQAVVYISGQKKGD---VVT
3g17A           VIIIAVKTHQLDAVIPHLTYLAHEDTLIILAQNGYGQLE----HIPFKNVCQAVVYISGQKKGD---VVT
3g17F           VIIIAVKTHQLDAVIPHLTYLAHEDTLIILAQNGY-------EHIPFKNVCQAVVYISGQKKGD---VVT


                         +         .         .         .         .         *         .:210
query           GTGTIELQPIASQDSAQEAKVIATLNSAGLNAEISPDVLLSIWKKAAFNSVMNTYCALLDCNVGGFGQRP
2ew2A           GDGEIELENIDPSGKKFALEVVDVFQKAGLNPSYSSNVRYSIWRKACVNGTLNGLCTILDCNIAEFGALP
2ew2B           GDGEIELENIDPSGKKFALEVVDVFQKAGLNPSYSSNVRYSIWRKACVNGTLNGLCTILDCNIAEFGALP
3hwrB           GRGELVIEP-----TSHGXXXXXXXXXXGVPVETSDNVRGALWAKLILNCAYNALSAITQLPYGRLVRGE
3hwrA           GRGELVIEP-----TSHGXXXXXXXXXXGVPVETSDNVRGALWAKLILNCAYNALSAITQLPYGRLVRGE
1yonA           ANGITHIGPARQQDGDYSADILQT---------VLPDVAAELWRKLAVNCVINPLTAIWNCPNGELRHHP
1yjqA           ANGITHIGPARQQDGDYSADILQT---------VLPDVAAELWRKLAVNCVINPLTAIWNCPNGELRHHP
2ofpB           ANGITHIGPARQQDGDYSADILQT---------VLPDVAAELWRKLAVNCVINPLTAIWNCPNGELRHHP
2ofpA           ANGITHIGPARQQDGDYSADILQT---------VLPDVAAELWRKLAVNCVINPLTAIWNCPNGELRHHP
1ks9A           ANGITHIGPARQQDGDYSADILQT---------VLPDVAAELWRKLAVNCVINPLTAIWNCPNGELRHHP
3hn2D           GAGRIILGEFLPRDTGRIEELAAMFRQAGVDCRTTDDLKRARWEKLVWNIPFNGLCALLQQPVNLILARD
3hn2B           GAGRIILGEFLPRDTGRIEELAAMFRQAGVDCRTTDDLKRARWEKLVWNIPFNGLCALLQQPVNLILARD
3hn2A           GAGRIILGEFLPRDTGRIEELAAMFRQAGVDCRTTDDLKRARWEKLVWNIPFNGLCALLQQPVNLILARD
3i83A           AYGRLMLGNYPGGVSERVKTLAAAFEEAGIDGIATENITTARWQKCVWNAAFNPLSVL----SGGL----
3i83B           AYGRLMLGNYPGGVSERVKTLAAAFEEAGIDGIATENITTARWQKCVWNAAFNPLSVL----SGGL----
3egoB           GLGAIKWSAFDDAE-PDRLNILFQHNHSDFPIYYETDWYRLLTGKLIVNACINPLTALLQVKNGELLTTP
3egoA           GLGAIKWSAFDDAE-PDRLNILFQHNHSDFPIYYETDWYRLLTGKLIVNACINPLTALLQVKNGELLTTP
3ghyB           NGRRLILGEPAGGASPRLASIAALFGRAGLQAECSEAIQRDIWFKLWGNMTMNPVSVLTGATCDRILDDP
3ghyA           NGRRLILGEPAGGASPRLASIAALFGRAGLQAECSEAIQRDIWFKLWGNMTMNPVSVLTGATCDRILDDP
3g17G           HFRDYQLR---IQDNALTRQFRDLVQDSQIDIVLEANIQQAIWYKLLVNLGINSITALGRQTV-AIMHNP
3g17E           HFRDYQLR---IQDNALTRQFRDLVQDSQIDIVLEANIQQAIWYKLLVNLGINSITALGRQTV-AIMHNP
3g17D           HFRDYQLR---IQDNALTRQFRDLVQDSQIDIVLEANIQQAIWYKLLVNLGINSITALGRQTV-AIMHNP
3g17C           HFRDYQLR---IQDNALTRQFRDLVQDSQIDIVLEANIQQAIWYKLLVNLGINSITALGRQTV-AIMHNP
3g17A           HFRDYQLR---IQDNALTRQFRDLVQDSQIDIVLEANIQQAIWYKLLVNLGINSITALGRQTV-AIMHNP
3g17F           HFRDYQLR---IQDNALTRQFRDLVQDSQIDIVLEANIQQAIWYKLLVNLGINSITALGRQTV-AIMHNP


                         .         .         .         +         .         .         .:280
query           GALDLAQAVVDEFVLVAASQNIPLTEQMVMNTVKKVFDPRESGHHYPSMHQDLHKGRLTEIDYLNGAIAR
2ew2A           VSESLVKTLISEFAAVAEKEAIYLDQAEVYTHIVQTYDPNGIGLHYPS-YQDLIKNRLTEIDYINGAVWR
2ew2B           VSESLVKTLISEFAAVAEKEAIYLDQAEVYTHIVQTYDPNGIGLHYPS-YQDLIKNRLTEIDYINGAVWR
3hwrB           GVEAVRD--VEECFAVARAEGVKLPDDVALAIRRIAETPRQSS----STAQDLARGKRSEIDHLNGLIVR
3hwrA           GVEAVRD--VEECFAVARAEGVKLPDDVALAIRRIAETPRQSS----STAQDLARGKRSEIDHLNGLIVR
1yonA           QEI---MQICEEVAAVIEREGHHTSAEDLRDYVMQVIDA--TAENISSMLQDIRALRHTEIDYINGFLLR
1yjqA           QEI---MQICEEVAAVIEREGHHTSAEDLRDYVMQVIDA--TAENISSMLQDIRALRHTEIDYINGFLLR
2ofpB           QEI---MQICEEVAAVIEREGHHTSAEDLRDYVMQVIDA--TAENISSMLQDIRALRHTEIDYINGFLLR
2ofpA           QEI---MQICEEVAAVIEREGHHTSAEDLRDYVMQVIDA--TAENISSMLQDIRALRHTEIDYINGFLLR
1ks9A           QEI---MQICEEVAAVIEREGHHTSAEDLRDYVMQVIDA--TAENISSMLQDIRALRHTEIDYINGFLLR
3hn2D           VSRKLVRGIMLEVIAGANAQG--LATFIADGYVDDMLEFTDAGEYKPSMEIDREEGRPLEIAAIFRTPLA
3hn2B           VSRKLVRGIMLEVIAGANAQG--LATFIADGYVDDMLEFTDAGEYKPSMEIDREEGRPLEIAAIFRTPLA
3hn2A           VSRKLVRGIMLEVIAGANAQG--LATFIADGYVDDMLEFTDAGEYKPSMEIDREEGRPLEIAAIFRTPLA
3i83A           DTLDIVRAIMQEIRAVAAANGHPLPEDIVEKNVASTY---KMPPYKTSMLVDFEAGQPMETEVILGNAVR
3i83B           DTLDIVRAIMQEIRAVAAANGHPLPEDIVEKNVASTY---KMPPYKTSMLVDFEAGQPMETEVILGNAVR
3egoB           AYLAFMKLVFQEACRILKLEN----EEKAWERVQAVCG--QTKENRSSMLVDVIGGRQTEADAIIGYLLK
3egoA           AYLAFMKLVFQEACRILKLEN----EEKAWERVQAVCG--QTKENRSSMLVDVIGGRQTEADAIIGYLLK
3ghyB           LVSAFCLAVMAEAKAIGARIGCPIEQSGEARSAV----TRQLG---TSMLQDAEAGPL-EIDALVASVRE
3ghyA           LVSAFCLAVMAEAKAIGARIGCPIEQSGEARSAV----TRQLGAFKTSM---LQRGPL-EIDALVASVRE
3g17G           EIRILCRQLLLDGCRVAQAEGLNFSEQTV-DTIMTIYQPDEMG---TSMYYDIVHQQPLEVEAIQGFIYR
3g17E           EIRILCRQLLLDGCRVAQAEGLNFSEQTV-DTIMTIYQPDEMG---TSMYYDIVHQQPLEVEAIQGFIYR
3g17D           EIRILCRQLLLDGCRVAQAEGLNFSEQTV-DTIMTIYQPDEMG---TSMYYDIVHQQPLEVEAIQGFIYR
3g17C           EIRILCRQLLLDGCRVAQAEGLNFSEQTV-DTIMTIYQPDEMG---TSMYYDIVHQQPLEVEAIQGFIYR
3g17A           EIRILCRQLLLDGCRVAQAEGLNFSEQTV-DTIMTIYQPDEMG---TSMYYDIVHQQPLEVEAIQGFIYR
3g17F           EIRILCRQLLLDGCRVAQAEGSEQTVDTIMTIYQGYPDEMGTSMYYDIVHQ-----QPLEVEAIQGFIYR


                         .         *         .         .         .         .         +:350
query           IGAQNNIAVPVNKLLTQLIHAKEAQ
2ew2A           KGQKYNVATPF-CALTQLVHGKE--
2ew2B           KGQKYNVATPF-CALTQLVHGKE--
3hwrB           RGDALGIPVPANRVLHALVRLIE--
3hwrA           RGDALGIPVPANRVLHALVRLIE--
1yonA           RARAHGIAVPENTRLFEMVKRKESE
1yjqA           RARAHGIAVPENTRLFEMVKRKESE
2ofpB           RARAHGIAVPENTRLFEMVKRKESE
2ofpA           RARAHGIAVPENTRLFEMVKRKESE
1ks9A           RARAHGIAVPENTRLFEMVKRKESE
3hn2D           YGAREGIAMPRVEMLATLL------
3hn2B           YGAREGIAMPRVEMLATLL------
3hn2A           YGAREGIAMPRVEMLATLL------
3i83A           AGRRTRVAIP---------------
3i83B           AGRRTRVAIP---------------
3egoB           -------------------------
3egoA           -------------------------
3ghyB           IGLHVGVPTPQIDTLLGLV------
3ghyA           IGLHVGVPTPQIDTLLGLV------
3g17G           RAREHNLDTP---------------
3g17E           RAREHNLDTP---------------
3g17D           RAREHNLDTP---------------
3g17C           RAREHNLDTP---------------
3g17A           RAREHNLDTP---------------
3g17F           RAREHNLDTP---------------