[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:glnS

[Show Plain Result]

#ERROR : Can't open dsspfile "1euyA.bssp"
#ERROR : Can't open dsspfile "1qruA.bssp"
#ERROR : Can't open dsspfile "1qrsA.bssp"
#ERROR : Can't open dsspfile "1qrtA.bssp"
#ERROR : Can't open dsspfile "2rd2A.bssp"
#ERROR : Can't open dsspfile "1nylA.bssp"
#ERROR : Can't open dsspfile "2hz7A.bssp"
#ERROR : Can't open dsspfile "2cfoB.bssp"
#ERROR : Can't open dsspfile "2cfoA.bssp"
#ERROR : Can't open dsspfile "2zlzA.bssp"
#ERROR : Can't open dsspfile "1nzjA.bssp"
#ERROR : Can't open dsspfile "1g59A.bssp"
#ERROR : Can't open dsspfile "2o5rA.bssp"
#ERROR : Can't open dsspfile "1j09A.bssp"

## Summary of PDB Search
:555
      0.0  96%  1euyA  [c.26.1 - b.53.1] GLUTAMINYL-TRNA SYNTHETASE
      0.0  96%  1qruA  [c.26.1 - b.53.1] PROTEIN (GLUTAMINYL-TRNA SYNTHETASE
      0.0  96%  1qrsA  [c.26.1 - b.53.1] PROTEIN (GLUTAMINYL-TRNA SYNTHETASE
      0.0  96%  1qrtA  [c.26.1 - b.53.1] PROTEIN (GLUTAMINYL-TRNA SYNTHETASE
      0.0  96%  2rd2A  [x.x.x] GLUTAMINYL-TRNA SYNTHETASE
      0.0  96%  1nylA  [c.26.1 - b.53.1] GLUTAMINYL-TRNA SYNTHETASE
    e-146  49%  2hz7A  [x.x.x] GLUTAMINYL-TRNA SYNTHETASE
    5e-16  34%  2cfoB  [x.x.x] GLUTAMYL-TRNA SYNTHETASE
    5e-16  34%  2cfoA  [x.x.x] GLUTAMYL-TRNA SYNTHETASE
    8e-10  30%  2zlzA  [x.x.x] GLUTAMYL-Q TRNA(ASP) SYNTHETASE
    8e-10  30%  1nzjA  [c.26.1] HYPOTHETICAL PROTEIN YADB
    9e-07  31%  1g59A  [c.26.1 - a.97.1] GLUTAMYL-TRNA SYNTHETASE
    1e-06  33%  2o5rA  [x.x.x] GLUTAMYL-TRNA SYNTHETASE 1
    1e-06  31%  1j09A  [c.26.1 - a.97.1] GLUTAMYL-TRNA SYNTHETASE
:555

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxTNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYQGQCNLRFDDTN
1euyA           --------TNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYKGQCNLRFDDTN
1qruA           --------TNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYKGQCNLRFDDTN
1qrsA           --------TNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYKGQCNLRFDDTN
1qrtA           --------TNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYKGQCNLRFDDTN
2rd2A           --------TNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYKGQCNLRFDDTN
1nylA           --------TNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYKGQCNLRFDDTN
2hz7A           ---------NFITEIIERDLEAGKYPRVVTRFPPDPSGYAHLGHVFASLLDFNTARQYGGQFNLRMDDTN
2cfoB           --------------------------TVRVRLAPSPTGNLHIGTARTAVFNWLYARHRGGKFILRIEDTD
2cfoA           --------------------------TVRVRLAPSPTGNLHIGTARTAVFNWLYARHRGGKFILRIEDTD
2zlzA           ------------------------------RFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDID
1nzjA           ------------------------------RFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDID
1g59A           ---------------------------VVTRIAPSPTGDPHVGTAYIALFNYAWARRNGGRFIVRIEDTD
2o5rA           ---------------------------VRVRFAPSPTGFLHVGGARTALFNFLFARKEKGKFILRIEDTD
1j09A           ---------------------------VVTRIAPSPTGDPHVGTAYIALFNYAWARRNGGRFIVRIEDTD


                         .         .         *         .         .         .         .:140
query           PVKEDIEYVDSIKNDVEWLGFHWSGDIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAP
1euyA           PVKEDIEYVESIKNDVEWLGFHWSGNVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQP
1qruA           PVKEDIEYVESIKNDVEWLGFHWSGNVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQTREYRGTLTQP
1qrsA           PVKEDIEYVESIKNDVEWLGFHWSGNVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQP
1qrtA           PVKEDIEYVESIKNDVEWLGFHWSGNVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQP
2rd2A           PVKEDIEYVESIKNDVEWLGFHWSGNVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQP
1nylA           P-KEDIEYVESIKNDVEWLGFHWSGNVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQP
2hz7A           PELARQEYVDSIADDLKWLGLDWGEHFYYASDYFDRYYAYAEQLIRQGDAYVESVSPEELSRLRGNATTP
2cfoB           RERSRPEYTENILEGLQWLGLTWDEGPYFQSDRLDLYRQAIQTLLDKGLAYYCYCTPEELEALRAEQKAK
2cfoA           RERSRPEYTENILEGLQWLGLTWDEGPYFQSDRLDLYRQAIQTLLDKGLAYYCYCTPEELEALRAEQKAK
2zlzA           PPREVPGAAETILRQLEHYGLHWDGDVLWQSQRHDAYREALAWLHEQGLSYYCTCTRARIQSIGG-----
1nzjA           PPREVPGAAETILRQLEHYGLHWDGDVLWQSQRHDAYREALAWLHEQGLSYYCTCTRARIQSIGG-----
1g59A           RARYVPGAEERILAALKWLGLSYTGPYR-QSERLPLYQKYAEELLKRGWAYRAFETPEELEQIR------
2o5rA           -XXXXXXXXXXXXXXXXWLGLLWDGPYR-QSERVEIYREHAERLVKEGKAY-------------------
1j09A           RARYVPGAEERILAALKWLGLSYDGPYR-QSERLPLYQKYAEELLKRGWAYRAFETPEELEQIR------


                         +         .         .         .         .         *         .:210
query           GKNSPFRDRSVEENLALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYP
1euyA           GKNSPYRDRSVEENLALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYP
1qruA           GKNSPYRDRSVEENLALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYP
1qrsA           GKNSPYRDRSVEENLALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYP
1qrtA           GKNSPYRDRSVEENLALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYP
2rd2A           GKNSPYRDRSVEENLALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYP
1nylA           GKNSPYRDRSVEENLALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYP
2hz7A           GTPSPYRDRSVEENLDLLRRMKAGEFADGEHVLRAKIDLTAPNMKLRDPVLYRIVNKPHFRTSDEWHIYP
2cfoB           GQAPRYDNRHTPEEQAAFE---------------------------------------------------
2cfoA           GQAPRYDNRHTPEEQAAFE---------------------------------------------------
2zlzA           ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1g59A           ----------------------------------------------------------------------
2o5rA           ----------------------------------------------------------------------
1j09A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MYDFTHCISDALEGITHSLCTLEFQDNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTD
1euyA           MYDFTHCISDALEGITHSLCTLEFQDNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTD
1qruA           MYDFTHCISDALEGITHSLCTLEFQDNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTD
1qrsA           MYDFTHCISDALEGITHSLCTLEFQNNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTD
1qrtA           MYDFTHCISDALEGITHSLCTLEFQGNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTD
2rd2A           MYDFTHCISDALEGITHSLRTLEFQDNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTD
1nylA           MYDFTHCISDALEGITHSLCTLEFQDNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTD
2hz7A           AYDFEHPLQDAIEGVTHSMCSLEFVDNRAIYDWLMEKLNFDPRPHQYEFGRRGLEYTITSKRKLRELVQA
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2zlzA           ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1g59A           ----------------------------------------------------------------------
2o5rA           ----------------------------------------------------------------------
1j09A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPV
1euyA           KHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPV
1qruA           KHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPV
1qrsA           KHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPV
1qrtA           KHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPV
2rd2A           KHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPV
1nylA           KHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGV-KQDNTIEMASLESCIREDLNENAPRAMAVIDPV
2hz7A           GRVSGWDDPRMPTLRAQRRLGVTPEAVRAFAAQIGVSRTNRTVDIAVYENAVRDDLNHRAPRVMAVLDPV
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2zlzA           ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1g59A           ----------------------------------------------------------------------
2o5rA           ----------------------------------------------------------------------
1j09A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KLVIENYPQGESEMVTMPNHPNKPEMGSREVPFSGEIWIDRADFREEANKQYKRLVMGKEVRLRNAYVIK
1euyA           KLVIENY-QGEGEMVTMPNHPNKPEMGSRQVPFSGEIWIDRADFREEANKQYKRLVLGKEVRLRNAYVIK
1qruA           KLVIENY-QGEGEMVTMPNHPNKPEMGSRQVPFSGEIWIDRADFREEANKQYKRLVLGKEVRLRNAYVIK
1qrsA           KLVIENY-QGEGEMVTMPNHPNKPEMGSRQVPFSGEIWIDRADFREEANKQYKRLVLGKEVRLRNAYVIK
1qrtA           KLVIENY-QGEGEMVTMPNHPNKPEMGSRQVPFSGEIWIDRADFREEANKQYKRLVLGKEVRLRNAYVIK
2rd2A           KLVIENY-QGEGEMVTMPNHPNKPEMGSRQVPFSGEIWIDRADFREEANKQYKRLVLGKEVRLRNAYVIK
1nylA           KLVIENY-QGEGEMVTMPNHPN-PEMGSRQVPFSGEIWIDRADFREEANKQYKRLVLGKEVRLRNAYVIK
2hz7A           KVTLTNL-DGE-KTLSLPYWPHAPEEAVRDVPLTRELYIERDDFSPAPPKGFKRLTPGGTVRLRGAGIIR
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2zlzA           ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1g59A           ----------------------------------------------------------------------
2o5rA           ----------------------------------------------------------------------
1j09A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AERVEKDAEGNITTIFCTYDADTLSKDPADGRKVKGVIHWVSAAHALPIEIRLYDRLFSVPNPGAAEDFL
1euyA           AERVEKDAEGNITTIFCTYDADTL-----------GVIHWVSAAHALPVEIRLYDRLFSVPNPGAADDFL
1qruA           AERVEKDAEGNITTIFCTYDADTL-----------GVIHWVSAAHALPVEIRLYDRLFSVPNPGAADDFL
1qrsA           AERVEKDAEGNITTIFCTYDADTL-----------GVIHWVSAAHALPVEIRLYDRLFSVPNPGAADDFL
1qrtA           AERVEKDAEGNITTIFCTYDADTL-----------GVIHWVSAAHALPVEIRLYDRLFSVPNPGAADDFL
2rd2A           AERVEKDAEGNITTIFCTYDADTL-----------GVIHWVSAAHALPVEIRLYDRLFSVPNPGAADDFL
1nylA           AERVEKDAEGNITTIFCTYDADTL------------VIHWVSAAHALPVEIRLYDRLFSVPNPGAADDFL
2hz7A           ADDFGTDEAGQVTHIRAT----LLGED----AKAAGVIHWVSAERALPAEFRLYDRLFRVPHPEGENGFM
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2zlzA           ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1g59A           ----------------------------------------------------------------------
2o5rA           ----------------------------------------------------------------------
1j09A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           SVINPESLVIKQGYGEPSLKAAVAGKAFQFEREGYFCLDSRYATADKLVFNRTVGLRDTWxxxxx
1euyA           SVINPESLVIKQGFAEPSLKDAVAGKAFQFEREGYFCLDSRHSTAEKPVFNRTVGLRDT------
1qruA           SVINPESLVIKQGFAEPSLKDAVAGKAFQFEREGYFCLDSRHSTAEKPVFNRTVGLRDT------
1qrsA           SVINPESLVIKQGFAEPSLKDAVAGKAFQFEREGYFCLDSRHSTAEKPVFNRTVGLRDT------
1qrtA           SVINPESLVIKQGFAEPSLKDAVAGKAFQFEREGYFCLDSRHSTAEKPVFNRTVGLRDT------
2rd2A           SVINPESLVIKQGFAEPSLKDAVAGKAFQFEREGYFCLDSRHSTAEKPVFNRTVGLRDT------
1nylA           SVINPESLVIKQGFAEPSLKDAVAGKAFQFEREGYFCLDSRH-TAEKPVFNRTVGLRD-------
2hz7A           RYLTPDSLRVLRGYVEPSVAGDPADTRYQFERQGYFWRDP-VELERVLVFGRIITLKDTW-----
2cfoB           -----------------------------------------------------------------
2cfoA           -----------------------------------------------------------------
2zlzA           -----------------------------------------------------------------
1nzjA           -----------------------------------------------------------------
1g59A           -----------------------------------------------------------------
2o5rA           -----------------------------------------------------------------
1j09A           -----------------------------------------------------------------