[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF68527.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ouvA.bssp"
#ERROR : Can't open dsspfile "1klxA.bssp"
#ERROR : Can't open dsspfile "2q7fA.bssp"
#ERROR : Can't open dsspfile "1mufA.bssp"
#ERROR : Can't open dsspfile "1mt6A.bssp"
#ERROR : Can't open dsspfile "1h3iA.bssp"

## Summary of PDB Search
:722
    1e-11  29%  1ouvA  [a.118.18] CONSERVED HYPOTHETICAL SECRETED PROTEIN
    8e-08  30%  1klxA  [a.118.18] CYSTEINE RICH PROTEIN B
    5e-05  28%  2q7fA  [x.x.x] YRRB PROTEIN
    1e-04  30%  1mufA  [b.76.2 - b.85.7] SET9
    3e-04  34%  1mt6A  [b.76.2 - b.85.7] SET9
    3e-04  34%  1h3iA  [b.76.2 - b.85.7] HISTONE H3 LYSINE 4 SPECIFIC
:722

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ouvA           ----------------------------------------------------------------------
1klxA           ----------------------------------------------------------------------
2q7fA           ----------------------------------------------------------------------
1mufA           ----------------------------------------------------------------------
1mt6A           ----------------------------------------------------------------------
1h3iA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ouvA           ----------------------------------------------------------------------
1klxA           ----------------------------------------------------------------------
2q7fA           ----------------------------------------------------------------------
1mufA           ----------------------------------------------------------------------
1mt6A           ----------------------------------------------------------------------
1h3iA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ouvA           ----------------------------------------------------------------------
1klxA           ----------------------------------------------------------------------
2q7fA           ----------------------------------------------------------------------
1mufA           ----------------------------------------------------------------------
1mt6A           ----------------------------------------------------------------------
1h3iA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ouvA           ----------------------------------------------------------------------
1klxA           ----------------------------------------------------------------------
2q7fA           ----------------------------------------------------------------------
1mufA           ----------------------------------------------------------------------
1mt6A           ----------------------------------------------------------------------
1h3iA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ouvA           ----------------------------------------------------------------------
1klxA           ----------------------------------------------------------------------
2q7fA           ----------------------------------------------------------------------
1mufA           ----------------------------------------------------------------------
1mt6A           ----------------------------------------------------------------------
1h3iA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ouvA           ----------------------------------------------------------------------
1klxA           ----------------------------------------------------------------------
2q7fA           ----------------------------------------------------------------------
1mufA           ----------------------------------------------------------------------
1mt6A           ----------------------------------------------------------------------
1h3iA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxYKHDVLDGDFEKWYENGHRESVYPYKNGMLNGDAKHWNEQGKLTYTTEYKDDKKQGADRRWSERTGKL
1ouvA           ----------------------------------------------------------------------
1klxA           ----------------------------------------------------------------------
2q7fA           ----------------------------------------------------------------------
1mufA           --------------------------YVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSL
1mt6A           --YVDDALQGQGVYTYEDGGVLQG-TYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSL
1h3iA           --YVDDALQGQGVYTYEDGGVLQG-TYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSL


                         *         .         .         .         .         +         .:560
query           VEEVMFANDERNGLKREFNDRTGKVLSALPYVDGDKEGTEEAYDEDGIKYIRCYHNDEELSELYAPTDVT
1ouvA           ----------------------------------------------------------------------
1klxA           ----------------------------------------------------------------------
2q7fA           ----------------------------------------EENKEDAIPYINFANLLSSVNELERALAFY
1mufA           VGEV--NEDGETGEKIAYVYPDERTALYGKFIDGEIEGTEEGRPHFELPGNSVYHFDKSTS---------
1mt6A           VGEV------------------------------------------------------------------
1h3iA           VGEV------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           NKAKQGDSTAQYHLGKYEFECTNYDAAMKWLTQSAEQNHPGALLFLAYAYNDGDGVAQDSKKYLSYLFKA
1ouvA           ----------------------NTNKALQYYSKACDLKYAEGCASLGGIYHDGKVVTRDFKKAVEYFTKA
1klxA           ----------------------NKQKLFQYLSKACELNSGNGCRFLGDFYENGKYVKKDLRKAAQYYSKA
2q7fA           DKALELDSTAYYGAGNVYVVKEMYKEAKDMFEKALRAGMENGDLF--YMLGTVLVKLEQPKLALPYLQRA
1mufA           ----------------------------------------------------------------------
1mt6A           ----------------------------------------------------------------------
1h3iA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           AELGESDAQLEVGYLNLIGEGMPKNLPEAYKWIKKSADQGNAQAHYNLGLMYRNGDGVEKDLNKAxxxxx
1ouvA           CDLNDGDGCTILGSLYDAGRGTPKDLKKALASYDKACDLKDSPGCFNAGNMYHHGEGATKNFKEA-----
1klxA           CGLNDQDGCLILGYKQYAGKGVVKNEKQAVKTFEKACRLGSEDA--------------------------
2q7fA           VELNENDTEARFQFMCLANEGMLDEALSQFAAVTEQ-DPGHADAFYNAGVTYAYKENREKAL--------
1mufA           ----------------------------------------------------------------------
1mt6A           ----------------------------------------------------------------------
1h3iA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxx
1ouvA           ----------------------
1klxA           ----------------------
2q7fA           ----------------------
1mufA           ----------------------
1mt6A           ----------------------
1h3iA           ----------------------