[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF68745.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cxbA.bssp"

## Summary of PDB Search
:408
    2e-05  34%  3cxbA  [x.x.x] PROTEIN SIFA
:408

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLWEKIKAYFFTTHHAEALECIFNLYHHQELNLTPVQVR
3cxbA           --------------------------------LWEKIKDFFFSTGKAKADRCLHEML-FAERAPTRERLT


                         .         .         *         .         .         .         .:140
query           GAYIKLRALASQGCKEQFIIESQEHADKLIIKDDNGENILSIEVECHPEAFGLAKEINKSHPKxxxxxxx
3cxbA           EIFFELKELACASQRDRFQVHNPHENDATIIMDQNEENELTFSCEVMGNLYFLMKDILKSHPQ-------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cxbA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cxbA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cxbA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cxbA           ----------------------------------------------------------