[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF68874.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1j1lA.bssp"
#ERROR : Can't open dsspfile "2p17A.bssp"
#ERROR : Can't open dsspfile "1tq5A.bssp"

## Summary of PDB Search
:286
    8e-31  38%  1j1lA  [b.82.1] PIRIN
    1e-23  36%  2p17A  [x.x.x] PIRIN-LIKE PROTEIN
    5e-12  31%  1tq5A  [x.x.x] PROTEIN YHHW
:286

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQQLSPFLLLDYAGPHTFTPGNEKRGVGEHPHRGFETVT
1j1lA           --------------------------------KNLDPFLLFDEF------KGGRPGGFPDHPHRGFETVS
2p17A           --------------------------------QEYDPFLLLEDIF--------ERGTFDVHPHRGIETVT
1tq5A           -------------------------------------------------------QGFGTHPHKD-EILT


                         .         .         *         .         .         .         .:140
query           IVYSGEVEHRDSTGRGGVIGPGDVQWMTAGAGILHEEFHSDAFTRRGGELEMVQLWVNLPMKDKMTPPGY
1j1lA           YLLEGGSAHEDFCGHTGK-NPGDLQW-TAGRGILHAEPCSEE------PAHGLQLWVNLRSSEKVEPQ-Y
2p17A           YVISGELEHFDSKAGHSTLGPGDVQW-TAGRGVVHKEDPAS-----GSTVHSLQLWVNLPSAYK-TEPRY
1tq5A           YVLEGTVEHQDS-GNKEQVPAGEFQ-ISAGTGIRHSEYNPSSTER----LHLYQIWI--PEENGIT-PRY


                         +         .         .         .         .         *         .:210
query           QSITHDVIPTVTLPDNAGVVRVIAGRYEETKGPAHTFSPLNVWDMRLQRNRQLTLAQPEGWSTALVVLKG
1j1lA           QELKSEEIPK---PSKDGVVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISG
2p17A           QNLRS---KDPVRKEEGATIRVFSGSSKGVKAPTKNIVPVTV--EIVEPGTTVVQDLPGHYNGFLYILEG
1tq5A           EQRRFDAV--------QGKQLVLSPDARDGSLKVHQDELYRWALLKDEQSVHQIAAERRVW---IQVVKG


                         .         .         .         +         .         .         .:280
query           NITVNGTTPVNEAQLVVLSQQGKTLHLEASSDASVLLLSGEPLNEPIVGYGPFVMNTKQEIAEAVRDFNS
1j1lA           DVYIDAQQKIEPHHTAVLG-EGDSVQVENKDPSHFVLIAGEPLREPVIQHGPFV-NTNEEISQAILDFRN
2p17A           SGVFGADNIEGKAQALFFSRHNRELNVTAREKLRLLLYAGEPVNEPV-----------------------
1tq5A           NVTINGVKASTSDGLAIWDEQAISIH--ADSDSEVLLFDLPPVH--------------------------


                         .         *         .         .         .         .         +:350
query           GRFGxx
1j1lA           AKNG--
2p17A           ------
1tq5A           ------