[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF69088.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"

## Summary of PDB Search
:491
    1e-25  37%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-20  38%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    8e-17  35%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    8e-17  35%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    9e-16  33%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    4e-15  31%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    8e-15  32%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-14  29%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    1e-14  29%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    5e-14  31%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    6e-12  26%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-12  26%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    8e-12  36%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    8e-12  36%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    1e-11  34%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-11  33%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-11  33%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-11  26%  2oukB  [x.x.x] PROTEIN ARTP
    3e-11  26%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    3e-11  38%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    1e-10  30%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    1e-10  28%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    1e-10  30%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-10  30%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-10  30%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-10  30%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-10  30%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    2e-10  31%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    3e-10  26%  1yqtA  [x.x.x] RNASE L INHIBITOR
    3e-10  30%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-10  30%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-10  29%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    4e-10  25%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    4e-10  25%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    6e-10  27%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    6e-10  27%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    7e-10  27%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    1e-09  35%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    1e-09  26%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-09  32%  2d2eA  [x.x.x] SUFC PROTEIN
    1e-09  30%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    2e-09  29%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-09  29%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-09  34%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-09  25%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    2e-09  25%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    2e-09  25%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    3e-09  32%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-09  25%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-09  32%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-09  26%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    4e-09  27%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    6e-09  29%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-08  27%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-08  27%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-08  40%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    2e-08  33%  2d2fA  [x.x.x] SUFC PROTEIN
    2e-08  33%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-08  38%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    4e-08  26%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    9e-08  31%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-08  31%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-08  31%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-08  31%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-08  31%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-07  26%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-07  26%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-07  32%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-07  30%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  30%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  30%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  30%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  30%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  30%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  30%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  30%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  30%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  30%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  30%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  30%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  30%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  30%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  30%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  30%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  26%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-07  30%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-07  27%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-07  31%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    6e-07  26%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    6e-07  31%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-06  24%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    1e-06  25%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  31%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-06  31%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-06  31%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-06  28%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  28%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    3e-06  28%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    4e-06  28%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-06  27%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-06  27%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-06  28%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-06  27%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-06  27%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-06  27%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-06  27%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-06  27%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-06  27%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  29%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    1e-05  28%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    1e-05  25%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-05  26%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  28%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    9e-05  35%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    2e-04  26%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-04  32%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    4e-04  26%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    4e-04  26%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    6e-04  28%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    8e-04  29%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    8e-04  35%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-08  32%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN(query 29->197)
    1e-08  29%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN(query 29->197)
    1e-08  30%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN(query 23->191)
    1e-08  30%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN(query 23->191)
    1e-09  28%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING(query 17->183)
    3e-08  29%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN(query 26->198)
    3e-08  29%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN(query 26->198)
    4e-09  32%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC(query 2->209)
    4e-09  32%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC(query 2->209)
    2e-07  28%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066(query 21->186)
    2e-05  27%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN(query 10->191)
    2e-05  27%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN(query 10->191)
    5e-08  32%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN(query 17->191)
    5e-08  32%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN(query 17->191)
    7e-08  35%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN(query 124->198)
    1e-09  30%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN(query 15->208)
    1e-09  30%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN(query 15->208)
    7e-05  30%  2oukB  [x.x.x] PROTEIN ARTP(query 136->204)
    7e-05  30%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER(query 136->204)
    4e-09  26%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1(query 4->183)
    2e-09  31%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING(query 283->465)
    1e-05  25%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA(query 10->198)
    2e-09  31%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 283->465)
    2e-09  31%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 283->465)
    2e-09  31%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 283->465)
    2e-09  31%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 283->465)
    2e-08  30%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN(query 23->191)
    4e-09  31%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 283->465)
    4e-09  31%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 283->465)
    1e-07  35%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN(query 105->183)
    2e-09  29%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID(query 261->434)
    4e-06  24%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG(query 4->198)
    2e-09  30%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID(query 261->434)
    1e-06  27%  2d2eA  [x.x.x] SUFC PROTEIN(query 260->461)
    3e-07  23%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN(query 23->210)
    8e-06  25%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A(query 23->198)
    8e-06  25%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A(query 23->198)
    2e-07  33%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 283->465)
    1e-06  28%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 23->203)
    1e-06  28%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 23->203)
    1e-06  28%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1(query 23->178)
    1e-08  29%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID(query 261->434)
    6e-07  30%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING(query 291->465)
    7e-08  28%  2d2fA  [x.x.x] SUFC PROTEIN(query 260->461)
    3e-06  28%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 23->203)
    2e-04  30%  1b0uA  [c.37.1] HISTIDINE PERMEASE(query 135->191)
    1e-05  25%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    1e-05  25%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    1e-05  25%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    1e-05  25%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    9e-05  25%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 15->198)
    3e-05  25%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    3e-05  25%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    3e-05  25%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    3e-05  25%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    3e-05  25%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    3e-05  25%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    3e-05  25%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    3e-05  25%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    3e-05  25%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    3e-05  25%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    3e-05  25%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    3e-05  25%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    3e-05  25%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    3e-05  25%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    3e-05  25%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    3e-05  25%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    2e-05  25%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 23->198)
    4e-04  23%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 14->198)
    5e-04  25%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 26->198)
    8e-04  27%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 136->198)
    2e-04  24%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 26->198)
    7e-05  24%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 7->198)
    4e-05  24%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 5->198)
    2e-05  25%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 7->198)
    7e-05  24%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 7->198)
    5e-04  25%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 26->198)
    6e-05  25%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 6->198)
    5e-04  23%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 26->198)
    5e-04  23%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 26->198)
    5e-04  23%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 26->198)
    3e-05  32%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING(query 122->191)
    3e-04  25%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 26->198)
    8e-04  27%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 136->198)
    3e-04  32%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD(query 279->488)
    8e-04  27%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 136->198)
    3e-04  35%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD(query 26->188)
:491

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSSLQISQGTFRLSDTKTLHLDSLTLNAGDSWAFVGANGSGKSALARALAGELPLLTGERQCRFTRITRL
2ihyB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1q12A           ----------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGSGDLFIGEKRMNDTPPAER
1pf4A           ----------------------------------------------------------------------
3fh6A           ----------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGSGDLFIGEKRMNDTPPAER
2awoC           ----------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2awoA           ----------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGSGDLFIGEKRMNDTPPAER
2awnB           ----------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGSGDLFIGEKRMNDTPPAER
1g291           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
1yqtA           ----------------------------------VGPNGTGKSTAVKILAGQLPNLCGDNDSWDGVIRAF
2r6gB           ----------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGSGDLFIGEKRMNDTPPAER
2r6gA           ----------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGSGDLFIGEKRMNDTPPAER
2yyzA           ----------------------------------------------------------------------
2ix3A           ------------------LNKTQLRLKRARRYGICGPNGCGKSTLMRAIAGQVDGFPTQEECRTVYVEH-
2iwhB           ------------------LNKTQLRLKRARRYGICGPNGCGKSTLMRAIAGQVDGFPTQEECRTVYVEH-
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1gajA           ----------------KALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNR
2hydA           ----------------------------------------------------------------------
1g6hA           ----------------KALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
2d2eA           ----------------------NLVVPKGEVHALMGPNGAGKSTLGKILAGD-PEYTVERG-----EILL
3dhwC           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2awnC           ----------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAG---LGVGMVFQSYALYPHL
2ix8A           ------------------LNKTQLRLKRARRYGICGPNGCGKSTLRAIANGQVDGFPTQEECRTVYVEH-
2iw3B           ------------------LNKTQLRLKRARRYGICGPNGCGKSTLRAIANGQVDGFPTQEECRTVYVEH-
2iw3A           ------------------LNKTQLRLKRARRYGICGPNGCGKSTLRAIANGQVDGFPTQEECRTVYVEH-
2zu0C           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1g9xA           ----------------KALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNR
1f3oA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
2d2fA           ----------------------NLVVPKGEVHALMGPNGAGKSTLGKILAGD-PEYTVERG-----EILL
2d3wD           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2qi9C           -------------------------VRAGEILHLVGPNGAGKSTLARAFAGQ-PLEAWSATKLALHRAYL
2bbsB           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2ihyB           ----------------------------GDKWILYGLNGAGKTTLLNILNAYEPATSGSAETVRQHIGFV
2ihyA           ----------------------------GDKWILYGLNGAGKTTLLNILNAYEPATSGT--VNLFGKPGY
2it1B           ----------------------NLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTEL
2it1A           ----------------------NLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTEL
3d31A           ----------------KNFSLDNLSLKSGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDL
2nq2C           -------------------------LNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIE------VYQ
2nq2D           -------------------------LNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIE------VYQ
3fvqB           -AALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSFSKNTNL
3fvqA           -AALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSFSKNTNL
2pjzA           --------------------LENINLEVGEKVIILGPNGSGKTTLLRAISGLLP---------YSGNIFI
1l2tB           ---------TYKMGEEIIYALKNVNLNIGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDL
1l2tA           ---------TYKMGEEIIYALKNVNLNIGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDL
1oxvA           ----------------KVVALDNVNINIGERFGILGPSGAGKTTFMRIIAGLDVPSTGE----------L
1oxsC           ----------------KVVALDNVNINIGERFGILGPSGAGKTTFMRIIAGLDVPSTGE----------L
1vplA           ----------------------------------------------------------------------
2yz2B           --------------EKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGD-----------
2yz2A           --------------EKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGD-----------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ---LKVEELNYNYSDTHALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPISRK
1q12A           ----------------------------------------------------------------------
1pf4A           ---------TYQGKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSRDYKLTNLRRF
3fh6A           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pcjA           ----------------------SLSVKKGEFVSIIGASGSGKSTLLYILGGKEVDYTNEKELSLLRNRKL
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
2hydA           ---IDIDHVSFQYNDNEAPILKNLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDF
1g6hA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3dhwC           ----------------------SLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTL
3g60A           ----------------------SLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQL
3g5uA           ----------------------SLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQL
2awnC           ----------------------------------------------------------------------
2zu0C           ----------------------SLDVHPGEVHAIMGPNGSGKSTLSATLAGRKDLLALSPEDRAGEGIFM
2d3wA           ----------------------SLDVHPGEVHAIMGPNGSGKSTLSATLAGRKDLLALSPEDRAGEGIFM
1jj7A           ----------------------TFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQY
1g9xA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d3wD           ----------------------SLDVHPGEVHAIMGPNGSGKSTLSATLAGRKDLLALSPEDRAGEGIFM
1b0uA           ----------------------------------------------------------------------
1xf9D           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1xf9C           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1xf9B           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1xf9A           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1xmjA           --------------ETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKHSGRISFCSQF
1r10A           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1r0zD           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1r0zC           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1r0zB           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1r0zA           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1r0xD           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1r0xC           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1r0xB           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1r0xA           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1r0wC           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1r0wB           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1r0wA           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1q3hD           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1q3hC           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1q3hB           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1q3hA           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
1xfaA           ----------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGI----IKHSGRV
2bbtB           -------------NNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEG----KIKHSGRI
2pzfA           -------------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKHSGRISFCSQF
2pzgB           ----------------------------------------------------------------------
2bboA           -------------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEG----KIKHSGRI
1xmiE           ------SFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEG----KIKHSGRI
1xmiC           ----QNSFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEG----KIKHSGRI
1xmiB           ------SFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEG----KIKHSGRI
1xmiA           ------SFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEG----KIKHSGRI
2pzfB           -------------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKHSGRISFCSQF
1xmiD           -----LSFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEG----KIKHSGRI
2pzgA           -------------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEG----KIKHSGRI
2pzeB           -------------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEG----KIKHSGRI
2pzeA           -------------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEG----KIKHSGRI
2d62A           ----------------------------------------------------------------------
2bbsA           -------------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEG----KIKHSGRI
2bbtA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1l7vC           -------------------------VRAGEILHLVGPNGAGKSTLARAFAGQ-PLEAWSATKLALHRAYL


                         .         .         *         .         .         .         .:140
query           SFEQLQKLVSDEWQRNNTDMLSPGEDDTGRTTAEIIQDEVHHPARCAMLAQQFGISALLDRRFKYLSTGE
2ihyB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1q12A           GVGMVFQSYALYPHLSVAENMSFGLKLAG-AKKEVINQRVNQVAEVLQLAH------LLDRKPKALSGGQ
1pf4A           ----------------------------------------------------------------------
3fh6A           GVGMVFQSYALYPHLSVAENMSFGLKLAG-AKKEVINQRVNQVAEVLQLAH------LLDRKPKALSGGQ
2awoC           PAERGVGMVALYPHLSVAENMSFGLKLAG-AKKEVINQRVNQVAEVLQLAH------LLDRKPKALSGGQ
2awoA           GVGMVFQSYALYPHLSVAENMSFGLKLAG-AKKEVINQRVNQVAEVLQLAH------LLDRKPKALSGGQ
2awnB           GVGMVFQSYALYPHLSVAENMSFGLKLAG-AKKEVINQRVNQVAEVLQLAH------LLDRKPKALSGGQ
1g291           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
1yqtA           RGNELQNYFEKLKNGEIRPVVKPQYVDLKAVKGKVIEKKADETGKXXXXXXXXXXXXXXXREIQHLSGGE
2r6gB           GVGMVFQSYALYPHLSVAENMSFGLKLAG-AKKEVINQRVNQVAEVLQLAH------LLDRKPKALSGGQ
2r6gA           GVGMVFQSYALYPHLSVAENMSFGLKLAG-AKKEVINQRVNQVAEVLQLAH------LLDRKPKALSGGQ
2yyzA           ----------------------------------------------------------------------
2ix3A           ---------DIDGTHSDTSVLD-FVFESGVGTKEAIKDKL----------IEFGFTEMIAMPISALSGGW
2iwhB           ---------DIDGTHSDTSVLD-FVFESGVGTKEAIKDKL----------IEFGFTEMIAMPISALSGGW
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1gajA           TFQTPQPLK----EMTVLENLLIGEINPGESPLNSLFYKKWIPKEEEMVEKAFKISHLYDRKAGELSGGQ
2hydA           ----------------------------------------------------------------------
1g6hA           EPAELRTFQTPQPLKEMTENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKAFKISHLYDRKAGELSGGQ
2d2eA           DGENILELSPDERARKGLFLAFQYPVVPGVTIANFLRLALQ-----AKLGREVGVAELLDYLSRYLNEGE
3dhwC           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2awnC           SV---------------AENMSFGLKLAG-AKKEVINQRVNQVAEVLQLAH------LLDRKPKALSGGQ
2ix8A           ---------DIDGTHSDTSVLD-FVFESGVGTKEAIKDKLIEFGFTDEIAP---ISAL---------SGG
2iw3B           ---------DIDGTHSDTSVLD-FVFESGVGTKEAIKDKLIEFGFTDEIAP---ISAL---------SGG
2iw3A           ---------DIDGTHSDTSVLD-FVFESGVGTKEAIKDKLIEFGFTDEIAP---ISAL---------SGG
2zu0C           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1g9xA           TFQTPQPLK----EMTVLENLLIGEINPGESPLNSLFYKKWIPKEEEMVEKAFKISHLYDRKAGELSGGQ
1f3oA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2onkA           ------------------------------------------------MAEKLGIAHLLDRKPARLSGGE
2d2fA           DGENILELSPDERARKGLFLAFQYPVEVGVTIANFLRLALQ-----AKLGREVGVAELLDWDESYLSRGE
2d3wD           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3bk7A           -----------------------------------------------------------DRELHQLSGGE
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2qi9C           SQQQTPPFATPVWH-----YLTLHQHDKTRT--ELLND----------VAGALALDDKLGRSTNQLSGGE
2bbsB           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2ihyB           SHSLLEKF--QEGERVIDVVISGAFKSIG--VYQDIDDEIRNEAH--QLLKLVG-SAKAQQYIGYLSTGE
2ihyA           SAETVRQHIGFV-SHSLLEKFQEGERVIDVVISGAIDDEIRNEAH--QLLKLVG-SAKAQQYIGYLSTGE
2it1B           PPKDRNVLVFQNWMTVYKNIAFPLE--LRKAPREEIDKKVRE------VAKMLHIDKLLNRYPWQLSGGQ
2it1A           PPKDRNVLVFQNWMTVYKNIAFPLE--LRKAPREEIDKKVRE------VAKMLHIDKLLNRYPWQLSGGQ
3d31A           SPEKHD--IAFVYQNYS---LFPHMNVKKNLEFGMRMKKIKDPKRVLDTARDLKIEHLLDRNPLTLSGGE
2nq2C           SIGFVPQFFSSPFAYSVLDIVLMGRSTHINTFAK----PKSHDYQVAMQALDYNLTHLAKREFTSLSGGQ
2nq2D           SIGFVPQFFSSPFAYSVLDIVLMGRSTHINTFAK----PKSHDYQVAMQALDYNLTHLAKREFTSLSGGQ
3fvqB           PVRELGYLVQETVYRNIAYGLGNGK---GRTAQE--------RQRIEAMLELTGISELAGRYPHELSGGX
3fvqA           PVRELGYLVQETVYRNIAYGLGNGK---GRTAQE--------RQRIEAMLELTGISELAGRYPHELSGGX
2pjzA           NGMEVRKIRN--YIRYSTNL--PEAYEIGVTVNDIVYEELKGLDRDLFLEMLKALKLILRRKLYKLSAGQ
1l2tB           DDDELTKIRRDKFQQFNLIPLL--------TALENVELPLIFKYRGAMSGEERRKRALLEERFNQLSGGQ
1l2tA           DDDELTKIRRDKFQQFNLIPLL--------TALENVELPLIFKYRGAMSGEERRKRALLEERFNQLSGGQ
1oxvA           YFD-------DRLVASNGKLIVPPED---RKIGMVFQTWALYPKRVEEVAKILDIHHVLNHFPRELSGGQ
1oxsC           YFD-------DRLVASNGKLIVPPED---RKIGMVFQTWALYPKRVEEVAKILDIHHVLNHFPRELSGGQ
1vplA           -----------------------------------------------------GLGEKIKDRVSTYSKGM
2yz2B           VLYDGERKKGYEIRRNIGIAFQYPED---QFFAERVFDEVRDPVPLVKKAMEFDFDSFKDRVPFFLSGGE
2yz2A           VLYDGERKKGYEIRRNIGIAFQYPED---QFFAERVFDEVRDPVPLVKKAMEFDFDSFKDRVPFFLSGGE
2oukB           -----------------------------------------------------------------LSGGQ
2oljA           -----------------------------------------------------------------LSGGQ
3gfoA           GIMKLRESIGIVFQDPDNQLFSASDVSFGAVNMKLPEDEIRKRVDNAL--KRTGIEHLKDKPTHCLSFGQ
1q12A           ----------------------------------------------------------------------
1pf4A           ALVSQNVHLFNDTIANNIAYAAEG---------EYTREQIEQAARQAH-AMEFGLDTVIGENGTSLSGGQ
3fh6A           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pcjA           GFVQFHYLIPELTALENVPMLKMGKP------------KKEAKERGEYLLSELGLGDKLSRKPYELSGGE
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2yyzA           ----------------------------------ISKDEVEK--RVVEIARKLLIDNLLDRKPTQLSGGQ
1gajA           ----------------------------------------------------------------------
2hydA           LTGSLRNQIGLVQQDNILFSDTVKENILGRPTAEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQ
1g6hA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3dhwC           SESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYLSGGQ
3g60A           NVQWLRAQLGIVSQEPILFDCSIAENIAGDNSRVVSYEEIVRAAKEANIHQ--FIDSLPDKKGTQLSGGQ
3g5uA           NVQWLRAQLGIVSQEPILFDCSIAENIAGDNSRVVSYEEIVRAAKEANIHQ--FIDSLPDKKGTQLSGGQ
2awnC           ----------------------------------------------------------------------
2zu0C           AFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMP---EDLLTRSVNVFSGGE
2d3wA           AFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMP---EDLLTRSVNVFSGGE
1jj7A           EHRYLHRQVAAVGQEPQVFGRSLQENTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQ
1g9xA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d3wD           AFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMP---EDLLTRSVNVFSGGE
1b0uA           ----------------------------------------------------------------HLSGGQ
1xf9D           SFSQFSWIMPGTIKENIISGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1xf9C           SFSQFSWIMPGTIKENIISGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1xf9B           SFSQFSWIMPGTIKENIISGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1xf9A           SFSQFSWIMPGTIKENIISGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1xmjA           SWENIIGVSYDEYRYRSVIKACQLEEDISKFAEK---DNI--------VLGEGGIT---------LSEGQ
1r10A           SFSQFSWIMPGTIKENIIFGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1r0zD           SFSQFSWIMPGTIKENIIFGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1r0zC           SFSQFSWIMPGTIKENIIFGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1r0zB           SFSQFSWIMPGTIKENIIFGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1r0zA           SFSQFSWIMPGTIKENIIFGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1r0xD           SFSQFSWIMPGTIKENIIFGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1r0xC           SFSQFSWIMPGTIKENIIFGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1r0xB           SFSQFSWIMPGTIKENIIFGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1r0xA           SFSQFSWIMPGTIKENIIFGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1r0wC           SFSQFSWIMPGTIKENIIFGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1r0wB           SFSQFSWIMPGTIKENIIFGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1r0wA           SFSQFSWIMPGTIKENIIFGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1q3hD           SFSQFSWIMPGTIKENIIFGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1q3hC           SFSQFSWIMPGTIKENIIFGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1q3hB           SFSQFSWIMPGTIKENIIFGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1q3hA           SFSQFSWIMPGTIKENIIFGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
1xfaA           SFSQFSWIMPGTIKENIIRGVSYDEYRYKSVVCQLQQDITKFAEQDNTVLGEGGVT---------LSGGQ
2bbtB           SF-----CSQNSW-------IMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLTLSGGQ
2pzfA           SWENIIGVSYDEYRYRSVIKACQLEEDISKFAEK---DNI--------VLGEGGIT---------LSGGQ
2pzgB           -----------------------------------------------------------------LSGGQ
2bboA           SFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEED----ISKFAEKDNI--VLGEGGITLSEGQ
1xmiE           SFSQFSWIMPGTIKENIIAGVSYDEYRYRSVACQLEEDISKFAEKDNIVLGEGGIT---------LSGGQ
1xmiC           SFSQFSWIMPGTIKENIIAGVSYDEYRYRSVACQLEEDISKFAEKDNIVLGEGGIT---------LSGGQ
1xmiB           SFSQFSWIMPGTIKEN--------------IIAGVSYDEYRYRSVIKACQLEEDISKIV----LTLSGGQ
1xmiA           SFSQFSWIMPGTIKENIIAGVSYDEYRYRSVACQLEEDISKFAEKDNIVLGEGGIT---------LSGGQ
2pzfB           SWENIIGVSYDEYRYRSVIKACQLEEDISKFAEK---DNI--------VLGEGGIT---------LSGGQ
1xmiD           SFSQFSWIMPGTIKEN--------------IIAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLSGGQ
2pzgA           SFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEED----ISKFAEKDNI--VLGEGGITLSGGQ
2pzeB           SFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEED----ISKFAEKDNI--VLGEGGITLSGGQ
2pzeA           SFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEED----ISKFAEKDNI--VLGEGGITLSGGQ
2d62A           ---------------------------------------------------ELGLTELLNRKPRELSGGQ
2bbsA           SF-----CSQNSW-------IMPGT--IKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDLITLSGGQ
2bbtA           -----------------------------------------------------------------LSGGQ
2qi9C           ----------------------------------------------------------------------
2bbsB           -----------------------------------------------------------------LSGGQ
1l7vC           SQQQTPPFATPVWH-----YLTLHQHDKTRT--ELLND----------VAGALALDDKLGRSTNQLSGGE


                         +         .         .         .         .         *         .:210
query           TRKALLCQALMSEPELLILDEPFDGLDVTARQQLAQRLTALNQAGMTLALVLNRFDEIPDFVQFAGVLAD
2ihyB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1q12A           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHRLGRTMIYV-------------------
1pf4A           ----------------------------------------------------------------------
3fh6A           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHRLGRTMIYV-------------------
2awoC           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHRLGRTMIYV-------------------
2awoA           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHRLGRTMIYV-------------------
2awnB           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHRLGRTMIYV-------------------
1g291           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
1yqtA           LQRVAIAAALLRNATFYFFDEPSSYLDIRQRLNAARAIRRLSEEGKSVLVVLAVLDYLSDIIHV--VYGE
2r6gB           RQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHRLGRTMIYV-------------------
2r6gA           RQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHRLGRTMIYV-------------------
2yyzA           ----------------------------------------------------------------------
2ix3A           KMKLALARAVLRNADILLLDEPTNHLDTV---NVAWLVNYLNTCGITSITISHDSVFLDNVCEYIINYEG
2iwhB           KMKLALARAVLRNADILLLDEPTNHLDTV---NVAWLVNYLNTCGITSITISHDSVFLDNVCEYIINYEG
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1gajA           MKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVM--
2hydA           ----------------------------------------------------------------------
1g6hA           MKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVM--
2d2eA           KKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFG-ALVITHYQRILNYIQ-------
3dhwC           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2awnC           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHRLGRTMIYV-------------------
2ix8A           WKKLALARAVLRNADILLLDEPTNHLDTV---NVAWLVNYLNTCGITSITISHDSVFLDNVCEYIINYEG
2iw3B           WKKLALARAVLRNADILLLDEPTNHLDTV---NVAWLVNYLNTCGITSITISHDSVFLDNVCEYIINYEG
2iw3A           WKKLALARAVLRNADILLLDEPTNHLDTV---NVAWLVNYLNTCGITSITISHDSVFLDNVCEYIINYEG
2zu0C           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1g9xA           MKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVM--
1f3oA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2onkA           RQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEEL--------------------------------
2d2fA           KKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFG-ALVITHYQRILNYIQ-------
2d3wD           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3bk7A           LQRVAIAAALLRKAHFYFFDEPSSYLDIRQRLKVARVIRRLANEGKAVLVVLAVLDYLSDVIHVVGVYG-
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2qi9C           WQRVRLAAVVLQAGQLLLLDEP-NSLDVAQQSALDKILSALSQQGLAI----------------------
2bbsB           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2ihyB           KQRVIA--RALGQPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIYVTHFIE-------------
2ihyA           KQRVIA--RALGQPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIYVTHFIE-------------
2it1B           QQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLKELGITTVYV-------------------
2it1A           QQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLKELGITTVYV-------------------
3d31A           QQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHK---------------------------
2nq2C           RQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSNMTVVFTTHQPNQV------------
2nq2D           RQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSNMTVVFTTHQPNQV------------
3fvqB           XXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDRE--EALQYADRIA-
3fvqA           XXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDRE--EALQYADRIA-
2pjzA           SVLVRTSLALASQPEIVGLDEPFENVDAARRHVISRYIKEYGKEGI------------------------
1l2tB           QQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEGKTVVVV-------------------
1l2tA           QQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEGKTVVVV-------------------
1oxvA           QQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVSRLGVTLLVV-------------------
1oxsC           QQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVSRLGVTLLVV-------------------
1vplA           VRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEV------------
2yz2B           KRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDRVVVL--
2yz2A           KRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDRVVVL--
2oukB           AQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGEVGDRVLF------
2oljA           AQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGEVGDRVLF------
3gfoA           KKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQK---------------------------
1q12A           ----------------------------------------------------------------------
1pf4A           RQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDEL-QKNKTVLVIAHRLSTI------------
3fh6A           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pcjA           QQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVMV-------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2yyzA           QQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQ---------------------------
1gajA           ----------------------------------------------------------------------
2hydA           KQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTL-IVAHRLSTI------------
1g6hA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3dhwC           KQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRLGLTILLITHEMDVVKRICDCVAVISN
3g60A           KQRIAIARALVRQPHILLLDEATSALD-TESEKVVQEALDKAREGRTCIVIAHRLSTI------------
3g5uA           KQRIAIARALVRQPHILLLDEATSALD-TESEKVVQEALDKAREGRTCIVIAHRLSTI------------
2awnC           ----------------------------------------------------------------------
2zu0C           KKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRD-GKRSFIIVTHYQRILDYIK-------
2d3wA           KKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRD-GKRSFIIVTHYQRILDYIK-------
1jj7A           RQAVALARALIRKPCVLILDDATSALDANSQLQVEQLL--------------------------------
1g9xA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d3wD           KKRNDILQMAVLEPELCILDES-DGLDIDALKVVADGVNSLRD-GKRSFIIVTHYQRILDYIK-------
1b0uA           QQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVV-------------------
1xf9D           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1xf9C           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1xf9B           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1xf9A           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1xmjA           QAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
1r10A           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1r0zD           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1r0zC           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1r0zB           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1r0zA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1r0xD           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1r0xC           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1r0xB           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1r0xA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1r0wC           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1r0wB           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1r0wA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1q3hD           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1q3hC           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1q3hB           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1q3hA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
1xfaA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHL------------
2bbtB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
2pzfA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
2pzgB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
2bboA           QAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
1xmiE           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
1xmiC           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
1xmiB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
1xmiA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
2pzfB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
1xmiD           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
2pzgA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
2pzeB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
2pzeA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
2d62A           RQRVALGRAIIRRPKVF-LDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYV-------------------
2bbsA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
2bbtA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
2qi9C           ----------------------------------------------------------------------
2bbsB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHL------------
1l7vC           WQRVRLAAVVLQAGQLLLLDEP-NSLDVAQQSALDKILSALCQQGLAI----------------------


                         .         .         .         +         .         .         .:280
query           CXXXXXXXXXXXXQRALVAQLAHSERLTDVQLPEPDEPSARHALPDGEPRIVLNDGVVSYNDRPILHHLS
2ihyB           --------------------------------------------------------------KTILKKIS
2ihyA           --------------------------------------------------------------KTILKKIS
2it1B           --------------------------------------------------IKLENIVKKFGNFTALNNIN
2it1A           --------------------------------------------------IKLENIVKKFGNFTALNNIN
3d31A           -----------------------------------------------------------------LDNLS
2nq2C           ----------------------------------------------------------------LFQQLN
2nq2D           --------------------------------------------------------------------LN
3fvqB           ----------------------------------------------------------SFQNTPVLNDIS
3fvqA           ----------------------------------------------------------SFQNTPVLNDIS
2pjzA           -------------------------------------------------------------ERFSLENIN
1l2tB           -----------------------------------------------------------------LKNVN
1l2tA           -----------------------------------------------------------------LKNVN
1oxvA           -----------------------------------------------------------------LDNVN
1oxsC           -----------------------------------------------------------------LDNVN
1vplA           ----------------------------------------------------------------------
2yz2B           -------------------------------------------------------------EKKALENVS
2yz2A           -------------------------------------------------------------EKKALENVS
2oukB           ----------------------------------------------------------SFGSLEVLKGIN
2oljA           ----------------------------------------------------------SFGSLEVLKGIN
3gfoA           -----------------------------------------------------------------LKGIN
1q12A           ----------------------------------------------------------------------
1pf4A           -------------------------------------------------------------EKPALSHVS
3fh6A           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1g291           -----------------------------------------------------------------VREMS
2pcjA           ----------------------------------------------------------------ILKGIS
1yqtA           PGVYGIFSQPKGTRNGINEFLRGYLKDENVRF----RPYEIKFTKTGERVEIERETLVTY-PRLVKDYGS
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2yyzA           --------------------------------------------------------------------VS
2ix3A           LKLRKYKGNFTEFVKKCPAAKAYEESNTDLEFKFP-EPGYLEGVKTKQKAIVVTNMEFQYTSKPQITDIN
2iwhB           LKLRKYKGNFTEFVKKCPAAKAYEESNTDLEFKFP-EPGYLEGVKTKQKAIVVTNMEFQYTSKPQITDIN
1mv5D           ----------------------------------------------------------AYDDEQILRDIS
1mv5A           ----------------------------------------------------------AYDDEQILRDIS
1gajA           ----------------------------------------------------------------------
2hydA           -------------------------------------------------RIDIDHVSFQYNDNPILKDIN
1g6hA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3dhwC           -----------------------------------------------------------------LNNVS
3g60A           --------------------------------PEIDSYSTQGLKPNMLEGNVQFSGVVNYPTRPVLQGLS
3g5uA           --------------------------------PEIDSYSTQGLKPNMLEGNVQFSGVVNYPTRPVLQGLS
2awnC           ----------------------------------------------------------------------
2ix8A           LKLRKYKGNFTEFVKKCPAAKAYEELSTDLEFKFP-EPGYLEGVKTKQKAIVKVTNEFQYTSKPQITDIN
2iw3B           LKLRKYKGNFTEFVKKCPAAKAYEELSTDLEFKFP-EPGYLEGVKTKQKAIVKVTNEFQYTSKPQITDIN
2iw3A           LKLRKYKGNFTEFVKKCPAAKAYEELSTDLEFKFP-EPGYLEGVKTKQKAIVKVTNEFQYTSKPQITDIN
2zu0C           ----------------------------------------------------IKDLHVSVEDKAILRGLS
2ixfD           --------------------------------------------------VKFQDVSFAYPNHPVLQGLT
2d3wA           ----------------------------------------------------IKDLHVSVEDKAILRGLS
1jj7A           -----------------------------------------------EGLVQFQDVSFAYPNRPVLQGLT
1g9xA           ----------------------------------------------------------------------
1f3oA           -----------------------------------------------------------------LKNVN
2ixfC           --------------------------------------------------VKFQDVSFAYPNHPVLQGLT
2ixfA           --------------------------------------------------VKFQDVSFAYPNHPVLQGLT
2onkA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------IKDLHVSVEDKAILRGLS
1b0uA           ----------------------------------------------------------------------
3bk7A           -IFSKPKGTRNGINEFLQGYLKDENRPYEIRFTKLSEDVERETLVE-YPRLVKDYGSFKLEVEP------
1xf9D           ---------------------------------------------------------------PVLKNIN
1xf9C           ---------------------------------------------------------------PVLKNIN
1xf9B           ---------------------------------------------------------------PVLKNIN
1xf9A           ---------------------------------------------------------------PVLKNIN
2d3wB           ----------------------------------------------------IKDLHVSVEDKAILRGLS
1xmjA           ---------------------------------------------------VVMENVTAFWETPVLKDIN
2ixeA           --------------------------------------------------VKFQDVSFAYPNHPVLQGLT
2d3wC           ----------------------------------------------------IKDLHVSVEDKAILRGLS
1r10A           ---------------------------------------------------------------PVLKNIN
1r0zD           ---------------------------------------------------------------PVLKNIN
1r0zC           ---------------------------------------------------------------PVLKNIN
1r0zB           ---------------------------------------------------------------PVLKNIN
1r0zA           ---------------------------------------------------------------PVLKNIN
1r0xD           ---------------------------------------------------------------PVLKNIN
1r0xC           ---------------------------------------------------------------PVLKNIN
1r0xB           ---------------------------------------------------------------PVLKNIN
1r0xA           ---------------------------------------------------------------PVLKNIN
1r0wC           ---------------------------------------------------------------PVLKNIN
1r0wB           ---------------------------------------------------------------PVLKNIN
1r0wA           ---------------------------------------------------------------PVLKNIN
1q3hD           ---------------------------------------------------------------PVLKNIN
1q3hC           ---------------------------------------------------------------PVLKNIN
1q3hB           ---------------------------------------------------------------PVLKNIN
1q3hA           ---------------------------------------------------------------PVLKNIN
2ixeD           --------------------------------------------------VKFQDVSFAYPNHPVLQGLT
1xfaA           ---------------------------------------------------------------PVLKNIN
2bbtB           ------------------------------------------------------------NNTPVLKDIN
1mt0A           ----------------------------------------------------------------ILDNIN
2ixgA           --------------------------------------------------VKFQDVSFAYPNHPVLQGLT
2ff7A           ----------------------------------------------------------------ILDNIN
1sgwA           -------------------------------------------------KLEIRDLSVGY-DKPVLERIT
2pzfA           --------------------------------------------------VVMENVTAFWGGTPVLKDIN
2fgkA           ----------------------------------------------------------------ILDNIN
2ffbA           ----------------------------------------------------------------ILDNIN
3b5jA           ----------------------------------------------------------------ILDNIN
2pzgB           ---------------------------------------------------------------PVLKDIN
1z47B           --------------------------------------------------------------------VS
1z47A           --------------------------------------------------------------------VS
2bboA           ---------------------------------------------------------------PVLKDIN
1xmiE           ---------------------------------------------------------------PVLKDIN
1xmiC           ---------------------------------------------------------------PVLKDIN
1xmiB           ---------------------------------------------------------------PVLKDIN
1xmiA           ---------------------------------------------------------------PVLKDIN
2pzfB           ---------------------------------------------------------------PVLKDIN
1xmiD           ---------------------------------------------------------------PVLKDIN
2pzgA           ---------------------------------------------------------------PVLKDIN
2pzeB           ---------------------------------------------------------------PVLKDIN
2pzeA           ---------------------------------------------------------------PVLKDIN
2d62A           -----------------------------------------------------------FGDVTAVKDLS
2ghiA           -----------------------------------------------------------------LKSIN
2bbsA           ---------------------------------------------------------------PVLKDIN
2bbtA           ---------------------------------------------------------------PVLKDIN
2ghiC           -----------------------------------------------------------------LKSIN
2qi9C           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------VLKDIN
1l7vC           --------------------------------------------------------------------LS
1z2rA           ---------------------------------------------------------------PALRNIN
3b60A           ---------------------------------------------------------------PALRNIN
2ghiB           -----------------------------------------------------------------LKSIN
2cbzA           ------------------------------------------------------------SDPPTLNGIT
2awnA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
1gajA           --------------------------------------------------ILRTENIVKYGEFKALDGVS
2hydA           ----------------------------------------------------------------------
1g6hA           --------------------------------------------------ILRTENIVKYGEFKALDGVS
2d2eA           -------------------------------------------------QLEIRDLWASIDGETILKGVN
3dhwC           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1g9xA           --------------------------------------------------ILRTENIVKYGEFKALDGVS
2onkA           ----------------------------------------------------------------------
2d2fA           -------------------------------------------------QLEIRDLWASIDGETILKGVN
2d3wD           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2qi9C           --------------------------------------------------------------------LS
2bbsB           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           WRVNPGEHWQIVGPNGAGKSTLLSLITGDHPQGYSNDLTLFGRRRGSGETIWDIKKHIGYVSSSLHLDYR
2ihyB           WQIAKGDKWILYGLNGAGKTTLLNILNAYEP-ATSGTVNLFGKPGKVGYSAETVRQHIGFVSHSLLEKFQ
2ihyA           WQIAKGDKWILYGLNGAGKTTLLNILNAYEP-ATSGTVNLFGKPGYSAET---VRQHIGFVSHSLLEKFQ
2it1B           LKIKDGEFMALLGPSGSGKSTLLYTIAGIY-------------KPTSGKIYFDEKRNVGLVFQNWAL-YP
2it1A           LKIKDGEFMALLGPSGSGKSTLLYTIAGIY-------------KPTSGKIYFDEKRNVGLVFQNWAL-YP
3d31A           LKVESGEYFVILGPTGAGKTLFLELIAGFHVPDS-------GRILLDGKDVTDLKHDIAFVYQNYSLFPH
2nq2C           FDLNKGDILAVLGQNGCGKSTLLDLLLGIH-------------RPIQGKI--EVYQSIGFVPQFFSSPFA
2nq2D           FDLNKGDILAVLGQNGCGKSTLLDLLLGIH-------------RPIQGKI--EVYQSIGFVPQFFSSPFA
3fvqB           LSLDPGEILFIIGASGCGKTTLLRCLAG-FEQPDSGEISLSGKTIFSKNTNLPVRRRLGYLVQEGVL-FP
3fvqA           LSLDPGEILFIIGASGCGKTTLLRCLAG-FEQPDSGEISLSGKTIFSKNTNLPVRRRLGYLVQEGVL-FP
2pjzA           LEVN-GEKVIILGPNGSGKTTLLRAISGLLP--YSGNIFI------NGMEVRKIRNYIRY-STNLPEAYE
1l2tB           LNIKEGEFVSIMGPSGSGKSTMLNIIGCDKPTEGEVYIDNIKTNDLDDDELTKIRRDIGFVFQQFNL-IP
1l2tA           LNIKEGEFVSIMGPSGSGKSTMLNIIGCDKPTEGEVYIDNIKTNDLDDDELTKIRRDIGFVFQQFNL-IP
1oxvA           INIENGERFGILGPSGAGKTTFMRIIAGDVPS--TGELYFDDRLVASGKLIVPPERKIGMVFQTWAL-YP
1oxsC           INIENGERFGILGPSGAGKTTFMRIIAGDVPS--TGELYFDDRLVASGKLIVPPERKIGMVFQTWAL-YP
1vplA           -------------PNGAGKTTTLRIIS-TLIKPSSGIVTVFGKN--VVEEPHEVRKLISYLPEE------
2yz2B           LVINEGECLLVAGNTGSGKSTLLQIVAG-LIEPTSGDVLYDGERKKG----YEIRRNIGYPEDQFFAE-R
2yz2A           LVINEGECLLVAGNTGSGKSTLLQIVAG-LIEPTSGDVLYDGERKKG----YEIRRNIGYPEDQFFAE-R
2oukB           VHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNLKAKDTNLNKVREEVGMVFQRFNL-FP
2oljA           VHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNLKAKDTNLNKVREEVGMVFQRFNL-FP
3gfoA           MNIKRGEVTAILGGNGVGKSTLF--------QNFNGIL-----KPSSGRILFD-NKPIDYSRKGI-MKLR
1q12A           ----------------------------------------------------------------------
1pf4A           FSIPQGKTVALVGRSGSGKSTIANLFTRFYDVD-SGSICLDGHDVRDYK-LTNLRRHFALVSQNVHL---
3fh6A           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1g291           LEVKDGEFMILLGPSGCGKTTTLRMIAGSRGQIYIGDKLVADPEKGIFVPPKD--RDIAMVFQSYAL-YP
2pcjA           LSVKKGEFVSIIGASGSGKSTLLYIL-GLLDAPTEGKVFLEGKETNEKELSLLRNRKLGFVFQFHYLIPE
1yqtA           FRVEPGEIKKIVGPNGIGKTTFVKLAGVEEPT--------------EGKIEWDLT--VAYKPQYIKADYE
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2yyzA           FEVKDGEFVALLGPSGCGKTTTLLMLAGIYKEIYFDDVLV--------NDIPPKYREVGMVFQNYAL-YP
2ix3A           FQCSLSSRIAVIGPNGAGKSTLINVLTGE-----------------------------------------
2iwhB           FQCSLSSRIAVIGPNGAGKSTLINVLTGE-----------------------------------------
1mv5D           FEAQPNSIIAFAGPSGGGKSTIFSLLERFY-QPTAGEITIDGQPIDN-ISLENWRSQIGFVSQDSAI---
1mv5A           FEAQPNSIIAFAGPSGGGKSTIFSLLERFY-QPTAGEITIDGQPIDN-ISLENWRSQIGFVSQDSAI---
1gajA           ----------------------------------------------------------------------
2hydA           LSIEKGETVAFVGMSGGGKSTLINLI----PRFY--DVTS-GQILIDGHNIKDLRNQIGLVQQDNIL---
1g6hA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3dhwC           LHVPAGQIYGVIGASGAGKSTLIRCVNLERPTEGSQELTTL-----SESELTKARRQIGMIFQHFNL-LS
3g60A           LEVKKGQTLALVGSSGCGKSTVVQLLERFYDP-MAGSVFLDGKEIKQLNVQW-LRAQLGIVSQEILFDCS
3g5uA           LEVKKGQTLALVGSSGCGKSTVVQLLERFYDP-MAGSVFLDGKEIKQLNVQW-LRAQLGIVSQEILFDCS
2awnC           ----------------------------------------------------------------------
2ix8A           FQCSLSSRIAVIGPNGAGKSTLINVLTGE-----------------------------------------
2iw3B           FQCSLSSRIAVIGPNGAGKSTLINVLTGE-----------------------------------------
2iw3A           FQCSLSSRIAVIGPNGAGKSTLINVLTGE-----------------------------------------
2zu0C           LDVHPGEVHAIMGPNGSGKSTLSATVTGGTVEFKGKDLLALSPEDRAGEGIFQYPVEIPGVSNQFFLQTA
2ixfD           FTLYPGKVTALVGPNGSGKSTVAALLQNLYPTG--------GKVLLDGEPLVQYDHHYLHTQVAAVGQLL
2d3wA           LDVHPGEVHAIMGPNGSGKSTLSATVTGGTVEFKGKDLLALSPEDRAGEGIFQYPVEIPGVSNQFFLQTA
1jj7A           FTLRPGEVTALVGPNGSGKSTVAALLQNLY-QPTGGQLLLDGKPLPQYEHRY-LHRQVAAVGQEPQVFGR
1g9xA           ----------------------------------------------------------------------
1f3oA           LNIKEGEFVSI-GPSGSGKSTLNIIGCLDKPTEGEVYIDNIKTNDLDDDELTKIRRDIGFVFQQFNL-IP
2ixfC           FTLYPGKVTALVGPNGSGKSTVAALLQNLYPTG--------------GKVLLDGEPLVQYDHHYLHTQVA
2ixfA           FTLYPGKVTALVGPNGSGKSTVAALLQNLYPTG--------------GKVLLDGEPLVQYDHHYLHTQVA
2onkA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d3wD           LDVHPGEVHAIMGPNGSGKSTLSATVTGGTVEFKGKDLLALSPEDRAGEGIFQYPVEIPGVSNQFFLQTA
1b0uA           ----------------------------------------------------------------------
3bk7A           GEIRKGEVIGIVGPNGIGKTTFVKMLAGEEPT--------------EGKVEWDLT--VAYKPQYIKAEY-
1xf9D           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1xf9C           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1xf9B           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1xf9A           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
2d3wB           LDVHPGEVHAIMGPNGSGKSTLSATVTGGTVEFKGKDLLALSPEDRAGEGIFQYPVEIPGVSNQFFLQTA
1xmjA           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQFSWI
2ixeA           FTLYPGKVTALVGPNGSGKSTVAALLQNLYPTG--------------GKVLLDGEPLVQYDHHYLHTQVA
2d3wC           LDVHPGEVHAIMGPNGSGKSTLSATVTGGTVEFKGKDLLALSPEDRAGEGIFQYPVEIPGVSNQFFLQTA
1r10A           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1r0zD           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1r0zC           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1r0zB           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1r0zA           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1r0xD           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1r0xC           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1r0xB           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1r0xA           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1r0wC           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1r0wB           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1r0wA           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1q3hD           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1q3hC           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1q3hB           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
1q3hA           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
2ixeD           FTLYPGKVTALVGPNGSGKSTVAALLQNLYPTG--------GKVLLDGEPLVQYDHHYLHTQVAAVGPLL
1xfaA           LNIEKGEMLAITGSTGSGKTSLLMLILGEL------------------EASEGIIKHSGRVSFCSQFSWI
2bbtB           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQNSWI
1mt0A           LSIKQGEVIGIVGRSGSGKSTLTKLIQRFYPE--NGQVLIDGHDLALADPNW-LRRQVGVVLQDNVLLNR
2ixgA           FTLYPGKVTALVGPNGSGKSTVAALLQNLYPTG--------------GKVLLDGEPLVQYDHHYLHTQVA
2ff7A           LSIKQGEVIGIVGRSGSGKSTLTKLIQRFYPE--NGQVLIDGHDLALADPNW-LRRQVGVVLQDNVLLNR
1sgwA           MTIEKGNVVNFHGPNGIGKTTLLKTIS-----TYLKPLK--GEIIYNGVPITKVKGKIFFLPEEIIVPRK
2pzfA           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQFSWI
2fgkA           LSIKQGEVIGIVGRSGSGKSTLTKLIQRFYPE--NGQVLIDGHDLALADPNW-LRRQVGVVLQDNVLLNR
2ffbA           LSIKQGEVIGIVGRSGSGKSTLTKLIQRFYPE--NGQVLIDGHDLALADPNW-LRRQVGVVLQDNVLLNR
3b5jA           LSIKQGEVIGIVGRAGSGKSTLTKLIQRFYPE--NGQVLIDGHDLALADPNW-LRRQVGVVLQDNVLLNR
2pzgB           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQFSWI
1z47B           FQIREGEMVGLLGPSGSGKTTILRLIAGERPT--KGDVWIGGKR------VTDLKRNVGLVFQNYAL-FQ
1z47A           FQIREGEMVGLLGPSGSGKTTILRLIAGERPT--KGDVWIGGKR------VTDLKRNVGLVFQNYAL-FQ
2bboA           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQFSWI
1xmiE           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQFSWI
1xmiC           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQFSWI
1xmiB           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQFSWI
1xmiA           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQFSWI
2pzfB           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQFSWI
1xmiD           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQFSWI
2pzgA           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQFSWI
2pzeB           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQFSWI
2pzeA           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQFSWI
2d62A           LEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPQIYIEDNLVADPEKG---VFVPPKERDVAVFQSYAL--Y
2ghiA           FFIPSGTTCALVGHTGSGKSTIAKLLYRFYDA--EGDIKIGGKNVNKYNRN-SIRSIIGIVPQDTIL---
2bbsA           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQNSWI
2bbtA           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQNSWI
2ghiC           FFIPSGTTCALVGHTGSGKSTIAKLLYRFYDA--EGDIKIGGKNVNKYNRN-SIRSIIGIVPQDTIL---
2qi9C           ----------------------------------------------------------------------
2bbsB           FKIERGQLLAVAGSTGAGKTSLLMMIMGE-------------LEPSEGKI-----KHSGRISFCSQNSWI
1l7vC           GEVRAGEILHLVGPNGAGKSTLLAR-AGTSGKGSI-------QFAGQPLEAWSATKHRAYLSQQQTPPF-
1z2rA           LKIPAGKTVALVGRSGSGKSTIASLITRDIDEGHGHDLREY--------TLASLRNQVALVSQNVHL---
3b60A           LKIPAGKTVALVGRSGSGKSTIASLITRDIDEGHGHDLREY--------TLASLRNQVALVSQNVHL---
2ghiB           FFIPSGTTCALVGHTGSGKSTIAKLLYRFYDA--EGDIKIGGKNVNKYNRN-SIRSIIGIVPQDTIL---
2cbzA           FSIPEGALVAVVGQVGCGKSSLLSALLADKVEGHVA-----------------IKGSVAYVPQQAWIQ--
2awnA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1q12A           --IHEGEFVVFVGPSGCGKSTLLRMIAGLETIT-SGDLFIGEKRMNDTPPA---ERGVGMVFQSYAL-YP
1pf4A           ----------------------------------------------------------------------
3fh6A           --IHEGEFVVFVGPSGCGKSTLLRMIAGLETIT-SGDLFIGEKRMNDTPPA---ERGVGMVFQSYAL-YP
2awoC           --IHEGEFVVFVGPSGCGKSTLLRMIAGLETIT-SGDLFIGEKRMNDTPPA---ERGVGMVALYPHL---
2awoA           --IHEGEFVVFVGPSGCGKSTLLRMIAGLETIT-SGDLFIGEKRMNDTPPA---ERGVGMVFQSYAL-YP
2awnB           --IHEGEFVVFVGPSGCGKSTLLRMIAGLETIT-SGDLFIGEKRMNDTPPA---ERGVGMVFQSYAL-YP
2pcjA           ----------------------------------------------------------------------
2r6gB           --IHEGEFVVFVGPSGCGKSTLLRMIAGLETIT-SGDLFIGEKRMNDTPPA---ERGVGMVFQSYAL-YP
2r6gA           --IHEGEFVVFVGPSGCGKSTLLRMIAGLETIT-SGDLFIGEKRMNDTPPA---ERGVGMVFQSYAL-YP
2yyzA           ----------------------------------------------------------------------
1gajA           ISVNKGDVTLIIGPNGSGKSTLINVITGDEGRVYFENKDITNKEPAE-------LYHYGIVRTFQTPQPL
2hydA           ----------------------------------------------------------------------
1g6hA           ISVNKGDVTLIIGPNGSGKSTLINVITGDEGRVYFENKDITNKEPAE-------LYHYGIVRTQTPQPLK
2d2eA           LVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILL-----DGENILELSPD-ERARKGLFLAFQ
3dhwC           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2awnC           --IHEGEFVVFVGPSGCGKSTLLRMIAG---------------------------LGVGMVFQSYAL-YP
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1g9xA           ISVCKGDVTLIIGPNGSGKSTLINVITGDEGRVYFENKDITNKEPAE-------LYHYGIVRTFQTPQPL
2onkA           ----------LLGPTGAGKSVFLELIAGIVKPDR-------GEVRLNGADITPLRRGIGFVPQDYALFPH
2d2fA           LVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILL-----DGENILELSPD-ERARKGLFLAFQ
2d3wD           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2qi9C           GEVRAGEILHLVGPNGAGKSTLLAR-AGTSGKGSI-------QFAGQPLEAWSATKHRAYLSQQQTPPF-
2bbsB           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VSTTVRNVILSGYFDSIGIYQAVSDRQRKLAQQWLDILGIDKRTADAPFHSLSWGQQRLALIVRALVKHP
2ihyB           EGERVIDVVISGAFKSIGVYQDIDDEIRNEAHQLLKLVGSAK--AQQYIGYLSTGEKQ-RVIARAL-GQP
2ihyA           EGERVIDVVISG---------AIDDEIRNEAHQLLKLVGSAK--AQQYIGYLSTGEKQ-RVIARAL-GQP
2it1B           HMTVYKNIAFP-----LELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQ-LSGGQQQRVAIARALVKEP
2it1A           HMTVYKNIAFP-----LELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQ-LSGGQQQRVAIARALVKEP
3d31A           MNVK-KNLEFGMRMKKIKDPKRVLDTARDLKIEHL----LDRNPL-----TLSGGEQQRVALARALVTNP
2nq2C           YS--VLDIVLMGRSTHINTFAKPKSHDYQVAMQALDYLNLT-HLAKREFTSLSGGQRQLILIARAIASEC
2nq2D           YS--VLDIVLMGRSTHINTFAKPKSHDYQVAMQALDYLNLT-HLAKREFTSLSGGQRQLILIARAIASEC
3fvqB           HLTVYRNIAY-----GLGNGKGRTAQERQRIEAMLELTGISELAGRYP-HELSGGXXXXXXXXXXXXPDP
3fvqA           HLTVYRNIAY-----GLGNGKGRTAQERQRIEAMLELTGISELAGRYP-HELSGGXXXXXXXXXXXXPDP
2pjzA           IGVTVNDIVY--------LYEELKGLDRDLFLEMLKALKLGEEILRRKLYKLSAGQSVLVRTSLALASQP
1l2tB           LLTALENVELPLIFKYRGAMSG--EERRKRALECLKMAELEERFANHKPNQLSGGQQQRVAIARALANNP
1l2tA           LLTALENVELPLIFKYRGAMSG--EERRKRALECLKMAELEERFANHKPNQLSGGQQQRVAIARALANNP
1oxvA           NLTAFENIAFP-----LTNMKMSKEEIRKRVEEVAKILDIHHVLNHFP-RELSGGQQQRVALARALVKDP
1oxsC           NLTAFENIAFP-----LTNMKMSKEEIRKRVEEVAKILDIHHVLNHFP-RELSGGQQQRVALARALVKDP
1vplA           -AGAYRNMQGIEYLRFVGFYASSSSEIEEMVERATEIAGLGEKIKDR-VSTYSKGMVRKLLIARALMVNP
2yz2B           VFDEVAFAVKNFYPDRDPV---------PLVKKAMEFVGLDFDSFKVPFF-LSGGEKRRVAIASVIVHEP
2yz2A           VFDEVAFAVKNFYPDRDPV---------PLVKKAMEFVGLDFDSFKVPFF-LSGGEKRRVAIASVIVHEP
2oukB           HMTVLNNITLA----PMKVRKWPREKAEAKAMELLDKVGL-KDKAHAYPDSLSGGQAQRVAIARALAMEP
2oljA           HMTVLNNITLA----PMKVRKWPREKAEAKAMELLDKVGL-KDKAHAYPDSLSGGQAQRVAIARALAMEP
3gfoA           ESIGIVFQDPDNQLFSASVYQDVSDEIRKRVDNALKRTGIE-HLKDKPTHCLSFGQKKRVAIAGVLVMEP
1q12A           ----------------------------------------------------------------------
1pf4A           FNDTIANNIAYAAEGEYTREQIEQAARQAHAMEFIENMGLDTVIGENGT-SLSGGQRQRVAIARALLRDA
3fh6A           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1g291           HMTVYDNIAFPLKLRKVP-RQEIDQRVREVAE----LLGLTELLNRKP-RELSGGQRQRVALGRAIVRKP
2pcjA           L-TALENVIVPML--KMG---KPKKEAKERGEYLLSELGLGDKLSRKPYE-LSGGEQQRVAIARALANEP
1yqtA           GTV----------YELLSKIDASKLNSNFYKTELLKPLGIID-LYDREVNELSGGELQRVAIAATLLRDA
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2yyzA           HMTVFENIAFPLRARRIS-KDEVEKRVVEIARKLLIDNLLDRKPTQ-----LSGGQQQRVALARALVKQP
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
1mv5D           MAGTIRENLLEGDYTDEDLWQVLDLAARSFVENMPDQLNTEVGERGV---KISGGQRQRLAIARAFLRNP
1mv5A           MAGTIRENLLEGDYTDEDLWQVLDLAARSFVENMPDQLNTEVGERGV---KISGGQRQRLAIARAFLRNP
1gajA           ----------------------------------------------------------------------
2hydA           FSDTVKENILLGRPTATD-EEVVEAAKMANAHDFIMNLGYDTEVGERGV-KLSGGQKQRLSIARIFLNNP
1g6hA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3dhwC           SRTVFGNVALPLELDN-----TPKDEVKRRVTELLSLVGLGDKHDSYP-SNLSGGQKQRVAIARALASNP
3g60A           IA---ENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPYNTRVGDKGTQ-LSGGQKQRIAIARALVRQP
3g5uA           IA---ENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPYNTRVGDKGTQ-LSGGQKQRIAIARALVRQP
2awnC           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2zu0C           LNASYRGQETLDRFD----FQDLMEEKIALLKMPEDLL---TRSVNVGF---SGGEKKRNDILQMAVLEP
2ixfD           FGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFGYDTEVGETG-NQLSGGQRQAVALARALIRKP
2d3wA           LNASYRGQETLDRFD----FQDLMEEKIALLKMPEDLL---TRSVNVGF---SGGEKKRNDILQMAVLEP
1jj7A           ---SLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLGYDTEVDEAG-SQLSGGQRQAVALARALIRKP
1g9xA           ----------------------------------------------------------------------
1f3oA           LLTALENVELPLIFKYRG---ASGEERRKRALECLKA-ELEERFANHKPNQLSGGQQQRVAIARALANNP
2ixfC           AGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFGYDTEVGETG-NQLSGGQRQAVALARALIRKP
2ixfA           AGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFGYDTEVGETG-NQLSGGQRQAVALARALIRKP
2onkA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d3wD           LNASYRGQETLDRFD----FQDLMEEKIALLKMPEDLL---TRSVNVGF---SGGEKKRNDILQMAVLEP
1b0uA           ---------------------------RERALKYLAKVGIDERAQGKPVH-LSGGQQQRVSIARALAMEP
3bk7A           -EGTVYELL-----SKIDSSKLNSNFYKTELLKPLGIIDLYDRNVE----DLSGGELQRVAIAATLLRDA
1xf9D           MPGTIKENIISGVYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1xf9C           MPGTIKENIISGVYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1xf9B           MPGTIKENIISGVYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1xf9A           MPGTIKENIISGVYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
2d3wB           LNASYRGQETLDRFD----FQDLMEEKIALLKMPEDLL---TRSVNVGF---SGGEKKRNDILQMAVLEP
1xmjA           MPGTIKENIIGVSYDEYRYRSVIKACQSKFAEKDNIVLGEGGIT-------LSEGQQAKISLARAVYKDA
2ixeA           AGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFGYDTEVGETG-NQLSGGQRQAVALARALIRKP
2d3wC           LNASYRGQETLDRFD----FQDLMEEKIALLKMPEDLL---TRSVNVGF---SGGEKKRNDILQMAVLEP
1r10A           MPGTIKNIIFGVSYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1r0zD           MPGTIKNIIFGVSYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1r0zC           MPGTIKNIIFGVSYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1r0zB           MPGTIKNIIFGVSYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1r0zA           MPGTIKNIIFGVSYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1r0xD           MPGTIKNIIFGVSYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1r0xC           MPGTIKNIIFGVSYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1r0xB           MPGTIKNIIFGVSYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1r0xA           MPGTIKNIIFGVSYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1r0wC           MPGTIKNIIFGVSYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1r0wB           MPGTIKNIIFGVSYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1r0wA           MPGTIKNIIFGVSYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1q3hD           MPGTIKNIIFGVSYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1q3hC           MPGTIKNIIFGVSYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1q3hB           MPGTIKNIIFGVSYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
1q3hA           MPGTIKNIIFGVSYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
2ixeD           FGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFGYDTEV------QLSGGQRQAVALARALIRKP
1xfaA           MPGTIKENIIRGVYDEYRYKSVVKACQTKFAEQDNTVLGEGGVT-------LSGGQRARISLARAVYKDA
2bbtB           MPGTIKENIIGVSYDEYRYRSVIKACQSKFAEKDNIVLGI----------TLSGGQRARISLARAVYKDA
1mt0A           --SIIDNISLANPGMSVEIYAAAHDFISELREGYNTIVGEQGA-------GLSGGQRQRIAIARALVNNP
2ixgA           AGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFGYDTEVGETG-NQLAVGQRQAVALARALIRKP
2ff7A           --SIIDNISLANPGMSVEIYAAAHDFISELREGYNTIVGEQGA-------GLSGGQRQRIAIARALVNNP
1sgwA           IS-------VEDYLKAVASLYGVKVNKNEIALESVEVLDLKKKLGE-----LSQGTIRRVQLASTLLVNA
2pzfA           MPGTIKENIIGVSYDEYRYRSVIKACQSKFAEKDNIVLGEGGIT-------LSGGQRARISLARAVYKDA
2fgkA           --SIIDNISLANPGMSVEIYAAAHDFISELREGYNTIVGEQGA-------GLSGGQRQRIAIARALVNNP
2ffbA           --SIIDNISLANPGMSVEIYAAAHDFISELREGYNTIVGEQGA-------GLSGGQRQRIAIARALVNNP
3b5jA           --SIIDNISLANPGMSVEIYAAAHDFISELREGYNTIVGEQGA-------GLSGGQRQRIAIARALVNNP
2pzgB           MPGTIKNIIFGVSYDEYRYRSVIKACQSKFAEKDNIVLGI----------TLSGGQRARISLARAVYKDA
1z47B           HMTVYDNV-------SFGLREVPKDEMDARVRELLRFMRLESYANRFP-HELSGGXXXXXXXXXXXXXXX
1z47A           HMTVYDNV-------SFGLREVPKDEMDARVRELLRFMRLESYANRFP-HELSGGXXXXXXXXXXXXXXX
2bboA           MPGTIKNIIFGVSYDEYRYRSVIKACQSKFAEKDNIVLGEGGIT-------LSEGQQAKISLARAVYKDA
1xmiE           MPGTIKENIIAGVSYDEYRYRSVEEDISKFAEKDNIVLGEGGIT-------LSGGQRARISLARAVYKDA
1xmiC           MPGTIKENIIAGVSYDEYRYRSVEEDISKFAEKDNIVLGEGGIT-------LSGGQRARISLARAVYKDA
1xmiB           MPGTIKENIIAGVSYDEYRYRSVI----KACQLEEDISKI--------VLTLSGGQRARISLARAVYKDA
1xmiA           MPGTIKENIIAGVSYDEYRYRSVEEDISKFAEKDNIVLGEGGIT-------LSGGQRARISLARAVYKDA
2pzfB           MPGTIKENIIGVSYDEYRYRSVIKACQSKFAEKDNIVLGEGGIT-------LSGGQRARISLARAVYKDA
1xmiD           MPGTIKENIIAGVSYDEYRYRSVI----KACQLEEDISKFEKDNIVLGEITLSGGQRARISLARAVYKDA
2pzgA           MPGTIKNIIFGVSYDEYRYRSVIKACQSKFAEKDNIVLGEGGIT-------LSGGQRARISLARAVYKDA
2pzeB           MPGTIKNIIFGVSYDEYRYRSVIKACQSKFAEKDNIVLGEGGIT-------LSGGQRARISLARAVYKDA
2pzeA           MPGTIKNIIFGVSYDEYRYRSVIKACQSKFAEKDNIVLGEGGIT-------LSGGQRARISLARAVYKDA
2d62A           PHTVYDNIAFPLKLRKVP-KQEIDKRVREVAE-----LGLTELLNRKP-RELSGGQRQRVALGRAIIRRP
2ghiA           FNETIKYNILYGKLDATDVIKATKSAQEALPKKWDTIVGNKGM-------KLSGGERQRIAIARCLLKDP
2bbsA           MPGTIKENIIGVSYDEYRYRSVI-----KACQLEEDISKFAEKD-NIVLITLSGGQRARISLARAVYKDA
2bbtA           MPGTIKENIIGVSYDEYRYRSVIKACQSKFAEKDNIVLG---------GITLSGGQRARISLARAVYKDA
2ghiC           FNETIKYNILYGKLDATEVIKATKSAQEALPKKWDTIVG-----------GMKLGERQRIAIARCLLKDP
2qi9C           ----------------------------------------------------------------------
2bbsB           MPGTIKENIIGVSYDEYRYRSVIKACQSKFAEKDNIVLG---------GITLSGGQRARISLARAVYKDA
1l7vC           -ATPVWHYLTLHQHDK---------TRTELLNDVAGALALDDKLGRST-NQLSWQRVRLAAVVLQITPQA
1z2rA           FNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMGLDTIIGENGV-LLSXXXXXXXXXXXXXXXDS
3b60A           FNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMGLDTIIGENGV-LLSXXXXXXXXXXXXXXXDS
2ghiB           FNETIKYNILYGKLDATDVIKATKSAQEALPKKWDTIVGNKMK--------LSGGERQRIAIARCLLKDP
2cbzA           -NDSLRENILFGCQLEEPYYRSVIQACALLPD--LEILPSGDRTEIGEKGNLSGGQKQRVSLARAVYSNA
2awnA           -------------------------------------------------------------IGRTLVAEP
2ihyB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1q12A           HLSVAENM-------SFGLKLAGAKKENQRVNQVAEVLQL-AHLLDRKPKALSGGQRQRVAIGRTLVAEP
1pf4A           ----------------------------------------------------------------------
3fh6A           HLSVAENM-------SFGLKLAGAKKENQRVNQVAEVLQL-AHLLDRKPKALSGGQRQRVAIGRTLVAEP
2awoC           --SVAENM-------SFGLKLAGAKKENQRVNQVAEVLQL-AHLLDRKPKALSGGQRQRVAIGRTLVAEP
2awoA           HLSVAENM-------SFGLKLAGAKKENQRVNQVAEVLQL-AHLLDRKPKALSGGQRQRVAIGRTLVAEP
2awnB           HLSVAENM-------SFGLKLAGAKKENQRVNQVAEVLQL-AHLLDRKPKALSGGQRQRVAIGRTLVAEP
2pcjA           ----------------------------------------------------------------------
2r6gB           HLSVAENM-------SFGLKLAGAKKENQRVNQVAEVLQL-AHLLDRKPKALSGGQRQRVAIGRTLVAEP
2r6gA           HLSVAENM-------SFGLKLAGAKKENQRVNQVAEVLQL-AHLLDRKPKALSGGQRQRVAIGRTLVAEP
2yyzA           ----------------------------------------------------------------------
1gajA           KEMTVLENLLIGEINNSLFYKKWIPKEEEMVEKAFKILEFLKHLYDRKAGELSGGQMKLVEIGRALMTNP
2hydA           ----------------------------------------------------------------------
1g6hA           EMTVLENLLIESPLNSL-FYKKWIPKEEEMVEKAFKILEFLKHLYDRKAGELSGGQMKLVEIGRALMTNP
2d2eA           YGVTIANFLRLALQAKLGREVGVAEFWTKV-KKALELLDWDESYLS---RYLNEGEKKRNEILQLLVLEP
3dhwC           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2awnC           HLSVAENM-------SFGLKLAGAKKENQRVNQVAEVLQL-AHLLDRKPKALSGGQRQRVAIGRTLVAEP
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1g9xA           KEMTVLENLLIGEINNSLFYKKWIPKEEEMVEKAFKILEFLKHLYDRKAGELSGGQMKLVEIGRALMTNP
2onkA           LSV-YRNI-------AYGLXXXXXXXXXXXXXXMAEKLGIAHLLDRKPAR-LSGGERQRVALARALVIQP
2d2fA           YPVEVPGVTIANFLRL--ALQAKLGREVGVAEFWLELLDWDESYLSRYLNGFSGGEKKRNEILQLLVLEP
2d3wD           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2qi9C           -ATPVWHYLTLHQHDK---------TRTELLNDVAGALALDDKLGRST-NQLSWQRVRLAAVVLQITPQA
2bbsB           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TVLILDEPLQGLDPLNRQLVRRFVDVLIRQGETQLLFVSHHAEDAPACITHRLEFVPEGERYKYVSGRCN
2ihyB           QVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIYVTHFIEEITA-----------------------
2ihyA           QVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIYVTHFIEEITA-----------------------
2it1B           EVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALA-MADRIAVIREGEKYKFVGGFLG
2it1A           EVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALA-MADRIAVIREGEKYKFVGGFLG
3d31A           KILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHITHDQTEA-RIMADRIAVVMDGK----------
2nq2C           KLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTVVFTTHQPNQVVA-----------------------
2nq2D           KLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTVVFTTHQPNQVVA-----------------------
3fvqB           ELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEA-------------------------
3fvqA           ELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEA-------------------------
2pjzA           EIVGLDEPFENVDAARRHVISRYIKEYGKEG----ILVTHELD---------------------------
1l2tB           PIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDIN--VARFGERIIYLKDGE----------
1l2tA           PIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDIN--VARFGERIIYLKDGE----------
1oxvA           SLLLLDEPFSNLDARMRDSARALVEVQSRLGVT-LLVVSHDPAD--------------------------
1oxsC           SLLLLDEPFSNLDARMRDSARALVEVQSRLGVT-LLVVSHDPAD--------------------------
1vplA           RLAILDEPTSGLDVLNAREVRKILKQASQEGLT--ILVSSH-----------------------------
2yz2B           DILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVIL-ISHDIE---------------------------
2yz2A           DILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVIL-ISHDIE---------------------------
2oukB           KIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVV------------VTHEMGFAREGDRVLFMDG---
2oljA           KIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVV------------VTHEMGFAREGDRVLFMDG---
3gfoA           KVLILDEPTAGLDPM-------------------------------------------------------
1q12A           ----------------------------------------------------------------------
1pf4A           PVLILDEATSALDTESERAIQAALDEL--QKNKTVLVIAH------------------------------
3fh6A           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1g291           QVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYVTHDQVEA-------------------------
2pcjA           ILLFADEPTGNLDSAN---TKRVMDIFINEGGTSIVMVTHERELAE--LTHRTLEMKDGK----------
1yqtA           DIYLLDEPSAYLDVEQRLAVSRAIRHLEKNEKTALV-VEH--DVLIDYVSDRLVF--EGEPGKY------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2yyzA           KVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITSVYVTHDQAEA-MTMASRIAVFNQGKLVQY------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
1mv5D           KILMLDEATASLDSESESMVQKALDSLMK-GRTTLV------------IAHRLSTIVDADKIYFI-----
1mv5A           KILMLDEATASLDSESESMVQKALDSLMK-GRTTLV------------IAHRLSTIVDADKIYFI-----
1gajA           ----------------------------------------------------------------------
2hydA           PILILDEATSALDLESESIIQEALDVLSKDRTT--LIVAHRL----STITH-------------------
1g6hA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3dhwC           KVLLCDEATSALDPTTRSILELLKDINRRLGLTILLIT--HEMDVVKRICDCVAVISNGE----------
3g60A           HILLLDEATSALDTESEKVVQEALD-KAREGRT-------------------------------------
3g5uA           HILLLDEATSALDTESEKVVQEALD-KAREGRT-------------------------------------
2awnC           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2zu0C           ELCILDESDSGLDIDALKVVADGVNSL-RDGKRSFIIVTHY-----------------------------
2ixfD           RLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLITHQLSLAER--AHHILFLKEG-----------
2d3wA           ELCILDESDSGLDIDALKVVADGVNSL-RDGKRSFIIVTHY-----------------------------
1jj7A           CVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQH-----------------------------
1g9xA           ----------------------------------------------------------------------
1f3oA           PIILADEPTGALDSKTGEKIQLLKKLNEEDGKTVVV------------VTHDINVARFGERIIYL-----
2ixfC           RLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLITHQLSLAER--AHHILFLKEG-----------
2ixfA           RLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLITHQLSLAER--AHHILFLKEG-----------
2onkA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d3wD           ELCILDES-DGLDIDALKVVADGVNSL-RDGKRSFIIVTHY-----------------------------
1b0uA           DVLLFDEPTSALDPELVGEVLRIMQQLAEEGKT-MVVVTHEMGFARHVSSHVI-FLHQGK----------
3bk7A           DIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEH------------------------------
1xf9D           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1xf9C           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1xf9B           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1xf9A           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
2d3wB           ELCILDES----DSLDIDALKVVADGVLRDGKRSFIIVTHY-----------------------------
1xmjA           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
2ixeA           RLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAER--AHHILFLKEG-----------
2d3wC           ELCILDES-DDIDAL--KVVADGVNSL-RDGKRSFIIVTHY-----------------------------
1r10A           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1r0zD           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1r0zC           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1r0zB           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1r0zA           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1r0xD           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1r0xC           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1r0xB           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1r0xA           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1r0wC           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1r0wB           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1r0wA           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1q3hD           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1q3hC           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1q3hB           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
1q3hA           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
2ixeD           RLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAER--AHHILFLKEG-----------
1xfaA           DLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-------------------------------
2bbtB           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
1mt0A           KILIFDEATSALDYESEHVIMRNMHKICK-GRTVII------------IAHRLSTVKNADR---------
2ixgA           RLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAER--AHHILFLKEG-----------
2ff7A           KILIFDEATSALDYESEHVIMRNMHKICK-GRTVII------------IAHRLSTVKNADR---------
1sgwA           EIYVLDDPVVAIDEDSKKVLKSILEILKEKG---------------------------------------
2pzfA           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
2fgkA           KILIFDQATSALDYESEHVIMRNMHKICK-GRTVII------------IAHRLSTVKNADR---------
2ffbA           KILIFDQATSALDYESEHVIMRNMHKICK-GRTVII------------IAHRLSTVKNADR---------
3b5jA           KILIFDEATSALDYESEHVIMRNMHKICK-GRTVII------------IAHRLSTVKNADR---------
2pzgB           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
1z47B           XXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVTHDQEEA-------------------------
1z47A           XXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVTHDQEEA-------------------------
2bboA           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
1xmiE           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
1xmiC           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
1xmiB           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
1xmiA           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
2pzfB           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
1xmiD           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
2pzgA           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
2pzeB           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
2pzeA           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
2d62A           KV-FLDEPLSNLDAKLR-VKRAELKKLQRQLGVTTIYVTHDQVEA-------------------------
2ghiA           KIVIFDEATSSLDSKTEYLFQKAVEDL-RKNRT-LIIIAH------------------------------
2bbsA           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
2bbtA           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
2ghiC           KIVIFDEATSSLDSKTEYLFQKAVEDL-RKNRT-LIIIAH------------------------------
2qi9C           ----------------------------------------------------------------------
2bbsB           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSEHLKKA-----DKILILHEGSSYFY------
1l7vC           NLLLLDEP-NSLDVAQQSALDKILSALCQQG---LAIVSSHDLNHTLRHAHRAWLLKGG---KLASGR--
1z2rA           PILILDEATSALDTESERAIQAALDEL--QKNRTSLVIAH------------------------------
3b60A           PILILDEATSALDTESERAIQAALDEL--QKNRTSLVIAH------------------------------
2ghiB           KIVIFDEATS--DSKTEYLFQKAVEDL-RKNRT-LIIIAH------------------------------
2cbzA           DIYLFDDPLSAVD---------------------------------------------------------
2awnA           SVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEA-------------------------
2ihyB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
1q12A           SVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEA-------------------------
1pf4A           ----------------------------------------------------------------------
3fh6A           SVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEA-------------------------
2awoC           SVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEA-------------------------
2awoA           SVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEA-------------------------
2awnB           SVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEA-------------------------
2pcjA           ----------------------------------------------------------------------
2r6gB           SVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEA-------------------------
2r6gA           SVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEA-------------------------
2yyzA           ----------------------------------------------------------------------
1gajA           KMIVMDQPIAGVAP--------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1g6hA           KMIVMDEPIAGVAP--------------------------------------------------------
2d2eA           TYAVLDETDSGLDIDALKVVARGVNAM-RGPNFGALVITHY-----------------------------
3dhwC           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2awnC           SVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEA-------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
1g9xA           KMIVMDEPIAGVAP--------------------------------------------------------
2onkA           RLLLLDEPLSAVDLKTKGVLMEELRFVQREFDVPILHVTHDLIEA-------------------------
2d2fA           TYAVLDETDSGLDIDALKVVARGVNAM-RGPNFGALVITHY-----------------------------
2d3wD           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2qi9C           NLLLLDEP-NSLDVAQQSALDKILSALSQQG---LAIVSSHDLNHTLRHAHRAWLLKGG---KLASGR--
2bbsB           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           N
2ihyB           -
2ihyA           -
2it1B           N
2it1A           N
3d31A           -
2nq2C           -
2nq2D           -
3fvqB           -
3fvqA           -
2pjzA           -
1l2tB           -
1l2tA           -
1oxvA           -
1oxsC           -
1vplA           -
2yz2B           -
2yz2A           -
2oukB           -
2oljA           -
3gfoA           -
1q12A           -
1pf4A           -
3fh6A           -
2awoC           -
2awoA           -
2awnB           -
1g291           -
2pcjA           -
1yqtA           -
2r6gB           -
2r6gA           -
2yyzA           -
2ix3A           -
2iwhB           -
1mv5D           -
1mv5A           -
1gajA           -
2hydA           -
1g6hA           -
2d2eA           -
3dhwC           -
3g60A           -
3g5uA           -
2awnC           -
2ix8A           -
2iw3B           -
2iw3A           -
2zu0C           -
2ixfD           -
2d3wA           -
1jj7A           -
1g9xA           -
1f3oA           -
2ixfC           -
2ixfA           -
2onkA           -
2d2fA           -
2d3wD           -
1b0uA           -
3bk7A           -
1xf9D           -
1xf9C           -
1xf9B           -
1xf9A           -
2d3wB           -
1xmjA           -
2ixeA           -
2d3wC           -
1r10A           -
1r0zD           -
1r0zC           -
1r0zB           -
1r0zA           -
1r0xD           -
1r0xC           -
1r0xB           -
1r0xA           -
1r0wC           -
1r0wB           -
1r0wA           -
1q3hD           -
1q3hC           -
1q3hB           -
1q3hA           -
2ixeD           -
1xfaA           -
2bbtB           -
1mt0A           -
2ixgA           -
2ff7A           -
1sgwA           -
2pzfA           -
2fgkA           -
2ffbA           -
3b5jA           -
2pzgB           -
1z47B           -
1z47A           -
2bboA           -
1xmiE           -
1xmiC           -
1xmiB           -
1xmiA           -
2pzfB           -
1xmiD           -
2pzgA           -
2pzeB           -
2pzeA           -
2d62A           -
2ghiA           -
2bbsA           -
2bbtA           -
2ghiC           -
2qi9C           -
2bbsB           -
1l7vC           -
1z2rA           -
3b60A           -
2ghiB           -
2cbzA           -
2awnA           -
2ihyB           -
2ihyA           -
2it1B           -
2it1A           -
3d31A           -
2nq2C           -
2nq2D           -
3fvqB           -
3fvqA           -
2pjzA           -
1l2tB           -
1l2tA           -
1oxvA           -
1oxsC           -
1vplA           -
2yz2B           -
2yz2A           -
2oukB           -
2oljA           -
3gfoA           -
1q12A           -
1pf4A           -
3fh6A           -
2awoC           -
2awoA           -
2awnB           -
2pcjA           -
2r6gB           -
2r6gA           -
2yyzA           -
1gajA           -
2hydA           -
1g6hA           -
2d2eA           -
3dhwC           -
3g60A           -
3g5uA           -
2awnC           -
2zu0C           -
2d3wA           -
1jj7A           -
1g9xA           -
2onkA           -
2d2fA           -
2d3wD           -
1b0uA           -
1xf9D           -
1xf9C           -
1xf9B           -
1xf9A           -
1xmjA           -
1r10A           -
1r0zD           -
1r0zC           -
1r0zB           -
1r0zA           -
1r0xD           -
1r0xC           -
1r0xB           -
1r0xA           -
1r0wC           -
1r0wB           -
1r0wA           -
1q3hD           -
1q3hC           -
1q3hB           -
1q3hA           -
1xfaA           -
2bbtB           -
2pzfA           -
2pzgB           -
2bboA           -
1xmiE           -
1xmiC           -
1xmiB           -
1xmiA           -
2pzfB           -
1xmiD           -
2pzgA           -
2pzeB           -
2pzeA           -
2d62A           -
2bbsA           -
2bbtA           -
2qi9C           -
2bbsB           -
1l7vC           -