[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF69275.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1wzoB.bssp"
#ERROR : Can't open dsspfile "1wzoC.bssp"
#ERROR : Can't open dsspfile "1gttA.bssp"
#ERROR : Can't open dsspfile "1wzoA.bssp"
#ERROR : Can't open dsspfile "1sawB.bssp"
#ERROR : Can't open dsspfile "1sawA.bssp"
#ERROR : Can't open dsspfile "2dfuB.bssp"
#ERROR : Can't open dsspfile "2dfuD.bssp"
#ERROR : Can't open dsspfile "2dfuA.bssp"
#ERROR : Can't open dsspfile "1nr9C.bssp"
#ERROR : Can't open dsspfile "1nr9A.bssp"
#ERROR : Can't open dsspfile "1nr9D.bssp"
#ERROR : Can't open dsspfile "1nr9B.bssp"
#ERROR : Can't open dsspfile "1nkqE.bssp"
#ERROR : Can't open dsspfile "1nkqA.bssp"
#ERROR : Can't open dsspfile "1nkqC.bssp"
#ERROR : Can't open dsspfile "1nkqF.bssp"
#ERROR : Can't open dsspfile "1nkqB.bssp"
#ERROR : Can't open dsspfile "2q1aX.bssp"
#ERROR : Can't open dsspfile "2q1dX.bssp"
#ERROR : Can't open dsspfile "2q19X.bssp"
#ERROR : Can't open dsspfile "2q18X.bssp"

## Summary of PDB Search
:292
    2e-29  41%  1wzoB  [x.x.x] HPCE
    1e-28  41%  1wzoC  [x.x.x] HPCE
    2e-28  40%  1gttA  [d.177.1 - d.177.1] 4-HYDROXYPHENYLACETATE DEGRADATION
    3e-28  40%  1wzoA  [x.x.x] HPCE
    7e-26  37%  1sawB  [d.177.1] HYPOTHETICAL PROTEIN FLJ36880
    7e-26  37%  1sawA  [d.177.1] HYPOTHETICAL PROTEIN FLJ36880
    2e-25  41%  2dfuB  [x.x.x] PROBABLE 2-HYDROXYHEPTA-2,4-DIENE-1,7-DIOATE
    5e-25  43%  2dfuD  [x.x.x] PROBABLE 2-HYDROXYHEPTA-2,4-DIENE-1,7-DIOATE
    5e-25  42%  2dfuA  [x.x.x] PROBABLE 2-HYDROXYHEPTA-2,4-DIENE-1,7-DIOATE
    2e-18  37%  1nr9C  [d.177.1] PROTEIN YCGM
    2e-18  37%  1nr9A  [d.177.1] PROTEIN YCGM
    3e-18  37%  1nr9D  [d.177.1] PROTEIN YCGM
    3e-18  37%  1nr9B  [d.177.1] PROTEIN YCGM
    9e-14  32%  1nkqE  [d.177.1] HYPOTHETICAL 28.8 KDA PROTEIN IN PSD1-SKO1
    9e-14  32%  1nkqA  [d.177.1] HYPOTHETICAL 28.8 KDA PROTEIN IN PSD1-SKO1
    2e-13  32%  1nkqC  [d.177.1] HYPOTHETICAL 28.8 KDA PROTEIN IN PSD1-SKO1
    4e-13  31%  1nkqF  [d.177.1] HYPOTHETICAL 28.8 KDA PROTEIN IN PSD1-SKO1
    1e-12  32%  1nkqB  [d.177.1] HYPOTHETICAL 28.8 KDA PROTEIN IN PSD1-SKO1
    1e-09  30%  2q1aX  [x.x.x] 2-KETO-3-DEOXY-D-ARABINONATE DEHYDRATASE
    1e-08  29%  2q1dX  [x.x.x] 2-KETO-3-DEOXY-D-ARABINONATE DEHYDRATASE
    1e-08  29%  2q19X  [x.x.x] 2-KETO-3-DEOXY-D-ARABINONATE DEHYDRATASE
    1e-08  29%  2q18X  [x.x.x] 2-KETO-3-DEOXY-D-ARABINONATE DEHYDRATASE
:292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYYYQEVTFLPVID
1wzoB           ----------------------------------------------------------------------
1wzoC           ----------------------------------------------------------------------
1gttA           ------------------------------------------------------------------PTLP
1wzoA           ----------------------------------------------------------------------
1sawB           ----------------------------------------------------------------------
1sawA           ----------------------------------------------------------------------
2dfuB           ---------------------------------------------------------YDLASVTLLPPAT
2dfuD           ---------------------------------------------------------YDLASVTLLPPAT
2dfuA           ---------------------------------------------------------YDLASVTLLPPAT
1nr9C           -------------------------------------------------------------------LLD
1nr9A           -------------------------------------------------------------------LLD
1nr9D           -------------------------------------------------------------------LLD
1nr9B           -------------------------------------------------------------------LLD
1nkqE           ----------------------------------------------------------------------
1nkqA           ----------------------------------------------------------------------
1nkqC           ----------------------------------------------------------------------
1nkqF           ----------------------------------------------------------------------
1nkqB           ----------------------------------------------------------------------
2q1aX           ----------------------------------------------------------------------
2q1dX           ----------------------------------------------------------------------
2q19X           ----------------------------------------------------------------------
2q18X           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DPQKIICVGMNYADKRIEFNETNPAPTLFVRFADSQTGHNGLLLKPENTNEFDYEGELAVVIGRRCSRVS
1wzoB           -PGKILGVALNYASRPEE-------PALFWKPNTSLLPHKGVVLYPKGARFVHYEVELAVVVGRPMKRVR
1wzoC           -PGKILGVALNYARPE--------EPALFWKPNTSLLPHKGVVLYPKGARFVHYEVELAVVVGRPMKRVR
1gttA           HPHTLFALGLNYADHPEE-------PLVFLKAPNTLTGDNQTSVRPNNIEYMHYEAELVVVIGKQARNVS
1wzoA           -PGKILGVALNYAGL-----SRPEEPALFWKPNTSLLPHKGVVLYPKGARFVHYEVELAVVVGRPMKRVR
1sawB           --KNIVCVGRNYASE----------PVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVP
1sawA           --KNIVCVGRNYASE----------PVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVP
2dfuB           -PTKIVCVGRNYPKEPGLFLK---GPNALARPGNPRDGTAEPVPYPFFTEELHYEGELAVVVGDRMRHVP
2dfuD           -PTKIVCVGRNYE------------PGLFLKGPNALAGTAEPVPYPFFTEELHYEGELAVVVGDRMRHVP
2dfuA           -PTKIVCVGRNYRLPK--------EPGLFLKGPNALAGTAEPVPYPFFTEELHYEGELAVVVGDRMRHVP
1nr9C           YPSKVVCVGSNYAPEE---------PVLFIKPETALCDLRQPLAIPSDFGSVHHEVELAVLIGATLRQAT
1nr9A           YPSKVVCVGSNYAPEE---------PVLFIKPETALCDLRQPLAIPSDFGSVHHEVELAVLIGATLRQAT
1nr9D           YPSKVVCVGSNYA--------VPEEPVLFIKPETALCDLRQPLAIPSDFGSVHHEVELAVLIGATLRQAT
1nr9B           YPSKVVCVGSNYA--------VPEEPVLFIKPETALCDLRQPLAIPSDFGSVHHEVELAVLIGATLRQAT
1nkqE           --RKIICIGRNYAAHIKELNNQKPTSSIVTPLSSSPANSTFNGLNEDGTNKVHHEIELALIVSKHLSNVT
1nkqA           --RKIICIGRNYAAHIKELNNQKPTSSIVTPLSSSPANSTFNGLNEDGTNKVHHEIELALIVSKHLSNVT
1nkqC           --RKIICIGRNYAAHIKEFFFLKPTSSIVTPLSSSPANSTFNGLNEDGTNKVHHEIELALIVSKHLSNVT
1nkqF           --RKIICIGRNYAAHQPFFFLKPTSSIVTPLSSPANSTFNGL--NEDGTNKVHHEIELALIVSKHLSNVT
1nkqB           --RKIICIGRNYAAHIKELQPSSPANSTFNGLNEDGT-NPGPIFIPRGV-KVHHEIELALIVSKHLSNVT
2q1aX           DPPEVWGSGISYEMARERYSEENVAPEIFFKATPNRCVGHGEAIAVRSDSEWTLEPELAVVL--------
2q1dX           -------------------------PEIFFKATPNRCVGHGEAIAVRSDSEWTLEPELAVVL--------
2q19X           -------------------------PEIFFKATPNRCVGHGEAIAVRSDSEWTLEPELAVVL--------
2q18X           -------------------------PEIFFKATPNRCVGHGEAIAVRSDSEWTLEPELAVVL--------


                         +         .         .         .         .         *         .:210
query           AEDALDYVAGYSCYMDGSVRDWQHSWFTAGKNWPSTGSFGPCLVTTDDIPDPQMLRLLTRLNGREVQNES
1wzoB           AKDALDYVLGYTIANDLVARDYVTNTFRPPIRAKGRDTFGPFLV-VEEVEDPQDLWLRAYVNGELRQEGH
1wzoC           AKDALDYVLGYTIANDLVARDYVTNTFRPPIRAKGRDTFGPFLV-VEEVEDPQDLWLRAYVNGELRQEGH
1gttA           EADAMDYVAGYTVCNDYAIRDYLENYYRPNLRVKSRDGLTPMLVPKEAIPDPHNLTLRTFVNGELRQQGT
1wzoA           AKDALDYVLGYTIANDLVARDYVRPPIRA-KGRDTFLPLGPFLV-VEEVEDPQDLWLRAYVNGELRQEGH
1sawB           EAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTAAFVPKEKIPDPHKLKLWLKVNGELRQEGE
1sawA           EAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTAAFVPKEKIPDPHKLKLWLKVNGELRQEGE
2dfuB           PEKALDHVLGYTVAVDITARDVQKKWVRA-KSADKFLPLGPWLET--DL-NPQDTWVRTYVNGTLRQEGH
2dfuD           PEKALDHVLGYTVAVDITARDVQKKWVRA-KSADKFLPLGPWLET--DL-NPQDTWVRTYVNGTLRQEGH
2dfuA           PEKALDHVLGYTVAVDITARDVQKKWVRA-KSADKFLPLGPWLET--DL-NPQDTWVRTYVNGTLRQEGH
1nr9C           EEHVRKAIAGYGVALDLTLRDVQGK-KKAGQPWEKAKAFDNSCPLSGFIPDPQNTTLSLSVNGEQRQQGT
1nr9A           EEHVRKAIAGYGVALDLTLRDVQGK-KKAGQPWEKAKAFDNSCPLSGFIPDPQNTTLSLSVNGEQRQQGT
1nr9D           EEHVRKAIAGYGVALDLTLRDVQGK-KKAGQPWEKAKAFDNSCPLSGFIPDPQNTTLSLSVNGEQRQQGT
1nr9B           EEHVRKAIAGYGVALDLTLRDVQGK-KKAGQPWEKAKAFDNSCPLSGFIPDPQNTTLSLSVNGEQRQQGT
1nkqE           KEEVYDSISGVALALDLTARNVQDEAKKKGLPWTISKGFDTAIVSREKFSSQDIFRVKCSVNGQLRQDGG
1nkqA           KEEVYDSISGVALALDLTARNVQDEAKKKGLPWTISKGFDTAIVSREKFSSQDIFRVKCSVNGQLRQDGG
1nkqC           KEEVYDSISGVALALDLTARNVQDEAKKKGLPWTISKGFDTAIVSREKFSSQDIFRVKCSVNGQLRQDGG
1nkqF           KEEVYDSISGVALALDLTARNVQDEAKKKGLPWTISKGFDTAIVSREKFSSQDIFRVKCSVNGQLRQDGG
1nkqB           KEEVYDSISGVALALDLTARNVQDEAKKKGLPWTISKGFDTAIVSREKFSSQDIFRVKCSVNGQLRQDGG
2q1aX           --DSNGKILGYTIMDDVSARDLEAEYLPQSKIYAGCCAFGPVIVTSDEIKNPYSLDITLKIEGRVFFEGS
2q1dX           --DSNGKILGYTIMDDVSARDLEAEYLPQSKIYAGCCAFGPVIVTSDEIKNPYSLDITLKIEGRVFFEGS
2q19X           --DSNGKILGYTIMDDVSARDLEAEYLPQSKIYAGCCAFGPVIVTSDEIKNPYSLDITLKIEGRVFFEGS
2q18X           --DSNGKILGYTIMDDVSARDLEAEYLPQSKIYAGCCAFGPVIVTSDEIKNPYSLDITLKIEGRVFFEGS


                         .         .         .         +         .         .         .:280
query           TANMIHPIASLIAYISTFTLLSPGDTILTGSPGGVGKKRVPPLFLHDGDVIEVEIEHIGTLRNVVRDSRY
1wzoB           TSRMLYSVAELLEFISEFMTLEPYDVLLTGTPKGISQVR-------PGDVMRLEIEGLGALENPIEE---
1wzoC           TSRMLYSVAELLEFISEFMTLEPYDVLLTGTPKGISQVR-------PGDVMRLEIEGLGALENPIEE---
1gttA           TADLIFSVPFLIAYLSEFMTLNPGDMIATGTPKGL-----------------------------------
1wzoA           TSRMLYSVAELLEFISEFMTLEPYDVLLTGTPKGISQVR-------PGDVMRLEIEGLGALENPIEE---
1sawB           TSSMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGP-------VKENDEIEAGIHGLVSMTFKVEKPEY
1sawA           TSSMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGP-------VKENDEIEAGIHGLVSMTFKVEKPEY
2dfuB           TSQMIFSVAEILSYISTFMTLEPLDVVLTGTPEGVGA-------LRPGDRLEVAVEGVGTLFTLI-----
2dfuD           TSQMIFSVAEILSYISTFMTLEPLDVVLTGTPEGVGA-------LRPGDRLEVAVEGVGTLFTLI-----
2dfuA           TSQMIFSVAEILSYISTFMTLEPLDVVLTGTPEGVGA-------LRPGDRLEVAVEGVGTLFTLI-----
1nr9C           TAD-IHKIVPLIAYSKFFT-LKAGDVVLTGTPDGVGP-------LQSGDELTVTFD--------------
1nr9A           TAD-IHKIVPLIAYSKFFT-LKAGDVVLTGTPDGVGP-------LQSGDELTVTFD--------------
1nr9D           TAD-IHKIVPLIAYSKFFT-LKAGDVVLTGTPDGVGP-------LQSGDELTVTFD--------------
1nr9B           TAD-IHKIVPLIAYSKFFT-LKAGDVVLTGTPDGVGP-------LQSGDELTVTFD--------------
1nkqE           T-NLLHPLHKILQHISTISL-EPGDIILTGTPAGVGE-------LKPGDRVHCEL---------------
1nkqA           T-NLLHPLHKILQHISTISL-EPGDIILTGTPAGVGE-------LKPGDRVHCEL---------------
1nkqC           T-NLLHPLHKILQHISTISL-EPGDIILTGTPAGVGE-------LKPGDRVHCEL---------------
1nkqF           T-NLLHPLHKILQHISTISL-EPGDIILTGTPAGVGE-------LKPGDRVHCEL---------------
1nkqB           T-NLLHPLHKILQHISTISL-EPGDIILTGTPAGVGE-------LKPGDRVHCEL---------------
2q1aX           TNKMRRKIEEQIQYLIRDNPIPDGTILTTGTAIVPGRDK----GLKDEDIVEITISNIGTLITPVKKRR-
2q1dX           TNKMRRKIEEQIQYLIRDNPIPDGTILTTGTAIVPGRDK----GLKDEDIVEITISNIGTLITPVKKRR-
2q19X           TNKMRRKIEEQIQYLIRDNPIPDGTILTTGTAIVPGRDK----GLKDEDIVEITISNIGTLITPVKKRR-
2q18X           TNKMRRKIEEQIQYLIRDNPIPDGTILTTGTAIVPGRDK----GLKDEDIVEITISNIGTLITPVKKRR-


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxx
1wzoB           ------------
1wzoC           ------------
1gttA           ------------
1wzoA           ------------
1sawB           ------------
1sawA           ------------
2dfuB           ------------
2dfuD           ------------
2dfuA           ------------
1nr9C           ------------
1nr9A           ------------
1nr9D           ------------
1nr9B           ------------
1nkqE           ------------
1nkqA           ------------
1nkqC           ------------
1nkqF           ------------
1nkqB           ------------
2q1aX           ------------
2q1dX           ------------
2q19X           ------------
2q18X           ------------