[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF69484.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "3ftjA.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "1ii8B.bssp"
#ERROR : Can't open dsspfile "1f2uD.bssp"
#ERROR : Can't open dsspfile "1f2uB.bssp"
#ERROR : Can't open dsspfile "1f2tB.bssp"
#ERROR : Can't open dsspfile "1w2hB.bssp"
#ERROR : Can't open dsspfile "1w2hA.bssp"
#ERROR : Can't open dsspfile "1n5lB.bssp"
#ERROR : Can't open dsspfile "1n5lA.bssp"
#ERROR : Can't open dsspfile "1n5kB.bssp"
#ERROR : Can't open dsspfile "1n5kA.bssp"
#ERROR : Can't open dsspfile "1g3uA.bssp"

## Summary of PDB Search
:648
    1e-51  46%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-51  46%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-47  47%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-39  41%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    3e-33  32%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    5e-33  37%  3ftjA  [x.x.x] MACROLIDE EXPORT ATP-BINDING/PERMEASE PROTEIN
    2e-27  37%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    2e-27  37%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    3e-26  32%  2oukB  [x.x.x] PROTEIN ARTP
    3e-26  32%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    4e-26  36%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    1e-25  35%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-25  35%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-25  35%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-25  35%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    2e-25  34%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-25  34%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-25  34%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    6e-25  34%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    1e-24  32%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    4e-24  32%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    4e-24  32%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    5e-24  34%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    5e-23  29%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    5e-23  29%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    7e-22  28%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    2e-21  34%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    2e-21  34%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    6e-21  34%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    6e-21  34%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    6e-21  34%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    6e-21  34%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-21  35%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    9e-21  39%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-20  34%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-20  34%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    6e-20  31%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    5e-19  31%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    7e-19  28%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    7e-19  28%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    2e-17  30%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    2e-17  30%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    2e-17  30%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    5e-17  30%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    5e-17  30%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    6e-17  36%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    1e-16  27%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-16  33%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    7e-16  30%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-15  30%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    5e-15  26%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-14  28%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-14  28%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-14  25%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    1e-14  29%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    1e-14  26%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-14  30%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-13  27%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-13  30%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    3e-13  32%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    3e-13  27%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    9e-13  32%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-13  32%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-12  26%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    2e-12  35%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-12  31%  1yqtA  [x.x.x] RNASE L INHIBITOR
    3e-12  33%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  32%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  29%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    4e-12  32%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  32%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-12  32%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-12  32%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-12  32%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  34%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  34%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  34%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  34%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  34%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  34%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  34%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  34%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  34%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  34%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  34%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  34%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  34%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  34%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  34%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  34%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  32%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  33%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  33%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    4e-11  30%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    4e-11  33%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-11  33%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-11  33%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-11  33%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-11  32%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-11  29%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    9e-11  35%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-11  34%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-11  34%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-11  34%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-11  34%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-10  28%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-10  33%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-10  30%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    7e-10  34%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    7e-10  34%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    7e-10  34%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    7e-10  34%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    7e-10  34%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    1e-09  29%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    2e-09  33%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-09  33%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-09  41%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-09  41%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-09  26%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    8e-09  34%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-08  32%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-08  41%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    3e-08  41%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    5e-08  34%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    5e-08  24%  1ji0A  [c.37.1] ABC TRANSPORTER
    5e-08  43%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    9e-08  34%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    1e-06  35%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    1e-06  35%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    1e-06  27%  2d2fA  [x.x.x] SUFC PROTEIN
    3e-06  28%  2d2eA  [x.x.x] SUFC PROTEIN
    9e-06  26%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    4e-05  26%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    4e-05  39%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    4e-05  39%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    4e-05  39%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    4e-04  30%  1ii8B  [c.37.1] RAD50 ABC-ATPASE
    4e-04  30%  1f2uD  [c.37.1] RAD50 ABC-ATPASE
    4e-04  30%  1f2uB  [c.37.1] RAD50 ABC-ATPASE
    4e-04  30%  1f2tB  [c.37.1] RAD50 ABC-ATPASE
    8e-04  58%  1w2hB  [x.x.x] THYMIDYLATE KINASE TMK
    8e-04  58%  1w2hA  [x.x.x] THYMIDYLATE KINASE TMK
    8e-04  58%  1n5lB  [c.37.1] THYMIDYLATE KINASE
    8e-04  58%  1n5lA  [c.37.1] THYMIDYLATE KINASE
    8e-04  58%  1n5kB  [c.37.1] THYMIDYLATE KINASE
    8e-04  58%  1n5kA  [c.37.1] THYMIDYLATE KINASE
    8e-04  58%  1g3uA  [c.37.1] THYMIDYLATE KINASE
:648

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGR
1l2tB           ---MIKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNI
1l2tA           ---MIKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNI
1f3oA           ----IKLKNVTKTY-KGEEIIYALKNVNLNIKEGEFVSI-GPSGSGKSTL-NIIGCLDKPTEGEVYIDNI
2pcjA           ----------------------ILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGK
3dhwC           ---MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQ
3ftjA           ----------------------------------------------------------------------
2it1B           ----IKLENIVKKFGN----FTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEK
2it1A           ----IKLENIVKKFGN----FTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEK
2oukB           ---MIDVHQLKKSFGSLE----VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXX
2oljA           ---MIDVHQLKKSFGSLE----VLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXX
1b0uA           ----------------------VLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGQ
3fh6A           --ASVQLQNVTKAWG----EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK
2awoA           --ASVQLQNVTKAWG----EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK
2awnB           --ASVQLQNVTKAWG----EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK
1q12A           ----VQLQNVTKAWG----EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK
2r6gB           --ASVQLQNVTKAWG----EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK
2r6gA           --ASVQLQNVTKAWG----EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK
3g60A           ----LEFKNIHFSYPSRKE-VQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQ
3g5uA           ----LEFKNIHFSYPSRKE-VQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQ
3d31A           ---MIEIESLSRKWKNFS-----LDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGK
1oxvA           ------VKNVSKVFKKGK--VVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDR
1oxsC           ------VKNVSKVFKKGK--VVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDR
2yyzA           -------------------KVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDV
1z47B           ----IEFVGVEKIYPGGARSV---RGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGK
1z47A           ----IEFVGVEKIYPGGARSV---RGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGK
1g291           -------------------EVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDK
1mt0A           ----ITFRNIRFRYKP--DSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGH
2ff7A           ----ITFRNIRFRYKP--DSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGH
2fgkA           ----ITFRNIRFRYKP--DSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGH
2ffbA           ----ITFRNIRFRYKP--DSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGH
3b5jA           ----ITFRNIRFRYKP--DSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGH
2awoC           ------------------QNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK
1pf4A           ----VDVKDVTFTY-QGKEKPA-LSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGH
2awnC           ------------------QNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRM-------------IAGL
1xefA           ----ITFRNIRFRYKP--DSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGH
2ffaA           ----ITFRNIRFRYKP--DSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGH
2hydA           ------------SFQYNDNEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGH
1jj7A           LEGLVQFQDVSFAYPNRPD-VLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQHRYLHR
3fvqB           -TAALHIGHLSKSF----QNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGK
3fvqA           -TAALHIGHLSKSF----QNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGK
1mv5D           ---MLSARHVDFAYDDSEQ---ILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQ
1mv5A           ---MLSARHVDFAYDDSEQ---ILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQ
2ixfD           MKGLVKFQDVSFAYPN-HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGE
2ixfC           MKGLVKFQDVSFAYPN-HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGE
2ixfA           MKGLVKFQDVSFAYPN-HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGE
2onkA           --------------------------------------LLGPTGAGKSVFLELIAGIVKPDRGEVRLNGA
1oxxK           ------VKNVSKVFKKGK--VVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDR
2d62A           --------------------VTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAG-LEEPTRGQIYI--E
2ixeA           MKGLVKFQDVSFAYPN-HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGE
2ixeD           MKGLVKFQDVSFAYPN-HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGE
1g6hA           -----------------------LDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENK
2yz2B           ----IEVVNVSHIFHRGTPEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGE
2yz2A           ----IEVVNVSHIFHRGTPEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGE
1gajA           -----------------------LDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENK
2ghiA           ----IEFSDVNFSYPK-QTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRF-YDAEGDIKIGGK
1g9xA           -----------------------LDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENK
2ixgA           MKGLVKFQDVSFAYPN-HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGE
1vplA           ------------------------------------------NGAGKTTTLRIISTLIKPSSGIVTVFGK
3gfoA           ---ILKVEELNYNYSDGTH---ALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNK
2ihyA           ---LIQLDQIGR-----KQGKTILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGK
2ghiC           ----IEFSDVNFSYPK-QTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRF-YDAEGDIKIGGK
2bbtA           ----------------------VLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
2bbsB           ----------------------VLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
1v43A           ----VKLENLTKRFGN----FTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDR
2awnA           --ASVQLQNVTKAWG----EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK
1yqtA           -----------------------------EIKKGEVIGIVGPNGIGKTTFVKLAG-VEEPTEG--KIEWD
1xmiD           ----------------------VLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
2pzgB           -TTEVVMENVTAFWEEGG--TPVLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
2ghiB           ----IEFSDVNFSYPK-QTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRF-YDAEGDIKIGGK
2pzeB           -TTEVVMENVTAFWEEGG--TPVLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
2pzeA           -TTEVVMENVTAFWEEGG--TPVLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
2pzgA           ------MENVTAFWEEGG--TPVLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
2bbsA           ----------------------VLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
2pzfB           -TTEVVMENVTAFWEEGG--TPVLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
1r10A           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1r0zD           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1r0zC           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1r0zB           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1r0zA           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1r0xD           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1r0xC           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1r0xB           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1r0xA           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1r0wC           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1r0wB           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1r0wA           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1q3hD           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1q3hC           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1q3hB           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1q3hA           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
2bbtB           ----------------------VLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
2pzfA           ----------------------VLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
2cbzA           -----------------------LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGS
2ihyB           ---LIQLDQIGR-----KQGKTILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGK
2bboA           ----------------------VLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
1xmiE           ----------------------VLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
1xmiC           ----------------------VLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
1xmiA           ----------------------VLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
1xmjA           -------------------ETPVLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
3bk7A           -----------------------------EIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEG--KVEWD
1xfaA           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1xf9D           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1xf9C           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1xf9B           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
1xf9A           ----------------------VLKNINLNIEKGEMLAITGSTGSGKSLLMLILGELEA-SEGIIKHSGR
2nq2C           ----------------------LFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVY--
1xmiB           ----------------------VLKDINFKIERGQLLAVAGSTGAGKSLLMMIMGELE-PSEGKIKHSGR
2nq2D           ------------------------QQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVY--
3b60A           -TGDLEFRNVTFTYPGRE--VPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGH
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1z2rA           -----EFRNVTFTYPGRE--VPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGH
2zu0C           ------------------EDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREEVTGGTVEFKGK
2d3wA           ------------------EDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREEVTGGTVEFKGK
2awoD           --ASVQLQNVTKAWG----EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK
2awnD           --ASVQLQNVTKAWG----EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK
2ghiD           -----------------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRF-YDAEGDIKIGGK
2d3wD           ------------------EDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREEVTGGTVEFKGK
2d3wB           ------------------EDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREEVTGGTVEFKGK
2r6fB           -----------------------LKNVSVKIPLGTFVAVTGVSGSGKSTLVN------------------
2r6fA           -----------------------LKNVSVKIPLGTFVAVTGVSGSGKSTLVN------------------
2qi9C           -----------------------LGPLSGEVRAGEILHLVGPNGAGKSTLLARAGTSGK---GSIQFAGQ
1ji0A           --------------------IHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQ
2d3wC           ------------------EDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREEVTGGTVEFKGK
1l7vC           -----------------------LGPLSGEVRAGEILHLVGPNGAGKSTLLARAGTSGK---GSIQFAGQ
2ix3A           --AIVKVTNMEFQYPGTSKPQ--ITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSG-------
2iwhB           --AIVKVTNMEFQYPGTSKPQ--ITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSG-------
2d2fA           ----LEIRDLWASI-DGE---TILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTRGEILLDGE
2d2eA           ----LEIRDLWASI-DGE---TILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTRGEILLDGE
1sgwA           ----LEIRDLSVGYDK-----PVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGV
2pjzA           ---MIQLKNVGITLSGKGYERFSLENINLEVN-GEKVIILGPNGSGKTTLLRAISGL-LPYSGNIFINGM
2ix8A           -----------------------ITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSG-------
2iw3B           -----------------------ITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSG-------
2iw3A           -----------------------ITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSG-------
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
1w2hB           -----------------------------------LIAIEGVDGAGKRTLVEKL-------SGAFRAAGR
1w2hA           -----------------------------------LIAIEGVDGAGKRTLVEKL-------SGAFRAAGR
1n5lB           -----------------------------------LIAIEGVDGAGKRTLVEKL-------SGAFRAAGR
1n5lA           -----------------------------------LIAIEGVDGAGKRTLVEKL-------SGAFRAAGR
1n5kB           -----------------------------------LIAIEGVDGAGKRTLVEKL-------SGAFRAAGR
1n5kA           -----------------------------------LIAIEGVDGAGKRTLVEKL-------SGAFRAAGR
1g3uA           -----------------------------------LIAIEGVDGAGKRTLVEKL-------SGAFRAAGR


                         .         .         *         .         .         .         .:140
query           DVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDY
1l2tB           KTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIYRGAMSGEERRKRALECLKMAELEEANH
1l2tA           KTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIYRGAMSGEERRKRALECLKMAELEEANH
1f3oA           KTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIYRGASGEERRKRALECLKAELEERFANH
2pcjA           EVDYTNEKELSLLRNRKLGFVFQFHYLIPELTALENVIVPMLKMGKPKKEAKERGEYLLSELGLGDKLSR
3dhwC           ELTTLSESELTKARRQ-IGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDS
3ftjA           ----------------------------------------------------------------------
2it1B           DVTELPP------KDRNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNR
2it1A           DVTELPP------KDRNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNR
2oukB           NLKAKDTNL--NKVREEVGMVFQRFNLFPHMTVLNNITLPMKVRKWPREKAEAKAMELLDKVGLKDKAHA
2oljA           NLKAKDTNL--NKVREEVGMVFQRFNLFPHMTVLNNITLPMKVRKWPREKAEAKAMELLDKVGLKDKAHA
1b0uA           NINLVDKDGQLKLLRTRLTMVFQHFNLWSHMTVLENVEAPIQVLGLSKHDARERALKYLAKVGIDERAQG
3fh6A           RMNDTPP------AERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDR
2awoA           RMNDTPP------AERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDR
2awnB           RMNDTPP------AERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDR
1q12A           RMNDTPP------AERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDR
2r6gB           RMNDTPP------AERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDR
2r6gA           RMNDTPP------AERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDR
3g60A           DIRTINVRYL----REIIGVVSQEPVLFA-TTIAENIDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGE
3g5uA           DIRTINVRYL----REIIGVVSQEPVLFA-TTIAENIDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGE
3d31A           DVTDLSPE------KHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDPKRVLDTARDLKIEHLLDR---
1oxvA           LVAS-NGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNH
1oxsC           LVAS-NGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNH
2yyzA           LVNDIPP------KYREVGMVFQNYALYPHMTVFENIAFPLRARRISKDEVEKRVVEIARKLLIDNLLDR
1z47B           RVTDLPP------QKRNVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRFMRLESYANR
1z47A           RVTDLPP------QKRNVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRFMRLESYANR
1g291           LVADPEKGIFVPPKDRDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELLGLTELLNR
1mt0A           DLALADPNWL----RRQVGVVLQDNVLLNR-SIIDNISLAVIYAA---KLAGAHDFISELREGYNTIVGE
2ff7A           DLALADPNWL----RRQVGVVLQDNVLLNR-SIIDNISLAVIYAA---KLAGAHDFISELREGYNTIVGE
2fgkA           DLALADPNWL----RRQVGVVLQDNVLLNR-SIIDNISLAVIYAA---KLAGAHDFISELREGYNTIVGE
2ffbA           DLALADPNWL----RRQVGVVLQDNVLLNR-SIIDNISLAVIYAA---KLAGAHDFISELREGYNTIVGE
3b5jA           DLALADPNWL----RRQVGVVLQDNVLLNR-SIIDNISLAVIYAA---KLAGAHDFISELREGYNTIVGE
2awoC           RMNDTPP------AERGVGMV----ALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDR
1pf4A           DVRDYK---LTNLRR-HFALVSQNVHLFND-TIANNIAYAAEYTREQIEQAARQAHAMEFIENMPQGLDT
2awnC           GV----------------GMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDR
1xefA           DLALADPNWL----RRQVGVVLQDNVLLNR-SIIDNISLAVIYAA---KLAGAHDFISELREGYNTIVGE
2ffaA           DLALADPNWL----RRQVGVVLQDNVLLNR-SIIDNISLAVIYAA---KLAGAHDFISELREGYNTIVGE
2hydA           NIK----DFLTGSLRNQIGLV-QQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNDTEVGE
1jj7A           QVAAVEPQVFGRSLQENIAYGLTQKPTMEEITAA------AVKSGAHSFISGLPQGY-------DTEVDE
3fvqB           TIFSKNTN--LPVRERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGR
3fvqA           TIFSKNTN--LPVRERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGR
1mv5D           PIDNIS----LENWRSQIGFVSQDSAIMAG-TIRENLTY-----GLEGDYTDEDLWQVLDLAFARSFVEN
1mv5A           PIDNIS----LENWRSQIGFVSQDSAIMAG-TIRENLTY-----GLEGDYTDEDLWQVLDLAFARSFVEN
2ixfD           PLVQYDHHYLAAVGQLLFGRSF-RENIAYGLTRTPTMEEITAVA----MESGAHDFISGFPQGYDTEVGE
2ixfC           PLVQYDHHYLAAVGQEPFGRSF-RENIAYGLTRTPTMEEITAVA----MESGAHDFISGFPQGYDTEVGE
2ixfA           PLVQYDHHYLAAVGQEPFGRSF-RENIAYGLTRTPTMEEITAVA----MESGAHDFISGFPQGYDTEVGE
2onkA           DITPLPPE------RRGIGFVPQDYALFPHLSVYRNIAYGLXXXXXXXXXXXXXXMAEKLGI--AHLLDR
1oxxK           LVAS-NGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNH
2d62A           DNLVADPEGVFVPPKERDVAVFQSYALYPH-TVYDNIAFPLKLRKV-PKQEIDKRVREVAELGLTELLNR
2ixeA           PLVQYDHHYLAAVGQEPFGRSF-RENIAYGLTRTPTMEEITAVA----MESGAHDFISGFPQGYDTEVGE
2ixeD           QVAAVGPLLFGRSFRENIAYGLTRTPTMEEITAV------AMESGAHDFISGFPQGYDTEV---------
1g6hA           DITNKEPAEL-----YHYGIVFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKADR
2yz2B           RKKGYEI-------RRNIGIAFQYQFFAERVFDEVAFAVKNFYPDRDPVPLVKKAMEFVGLDFDSFK-DR
2yz2A           RKKGYEI-------RRNIGIAFQYQFFAERVFDEVAFAVKNFYPDRDPVPLVKKAMEFVGLDFDSFK-DR
1gajA           DITNKEPAEL-----YHYGIVFQTPQPLKEMTVLENLLIGEINPGESPLNSLFYKKWIPKEEEMVEKADR
2ghiA           NVNKYNRNSI----RSIIGIVPQKYNILGKLDATDEEVIKATKSA------QLYDFIEALPKKWDTIVGN
1g9xA           DITNKEPAELY-----HYGIVFQTPQPLKEMTVLENLLIGEINPGESPLNSLFYKKWIPKEEEMVEKADR
2ixgA           PLVQYDHHYLAAVGQEPFGRSF-RENIAYGLTRTPTMEITAV-----AMESGAHDFISGFPQGYDTEVGE
1vplA           NVVE-EPHEVRKL----ISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKD
3gfoA           PID-YSRKGIMKLR-ESIGIVFQDPNQLFSASVYQDVSFGAVNMKLPEDEIRKRVDNALKRTGIEHLKDK
2ihyA           ------PGYSAETVRQHIGFV--SHSLLEKFQEGERV-IDVVISGAIDDEIRNEAHQLLKLVGSAKAQQY
2ghiC           NVNKYNRNSI----RSIIGIVPQDTILFNE-TIKYNILYGKLDATEEVIKATKSAQLYDFIEALPKKWDT
2bbtA           -ISFCSQNSWGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFA-------------------EKDNIVL
2bbsB           -ISFCSQNSWGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFA-------------------EKDNIVL
1v43A           DVTYLPP------KDRNISMVFQ------HMTVYENIAFP--LKKFPKDEIDKRVRWAAELLQIEELLNR
2awnA           RMNDTPP------AERGVGMVFQSYAL--------------------------------------EVINQ
1yqtA           LTVAYKPQ---YIKADYEGTV---YELLSKIDASK-------------LNSNFYKTELLKPLGIIDLYDR
1xmiD           QFSWIMPGTIKE--NIIAGVSYDEYRYRSVIKACQLEEDISKFA-------------------EKDNIVL
2pzgB           QFSWIMPGTIKE--NIIFGVSYDEYRYRSVIKACQLEEDISKFA-------------------EKDNIVL
2ghiB           NVNKYNRNSI----RSIIGIVPQKYNILYGKLDATDEEV------IKATKSAQLYDFIEALPKKWDTIVG
2pzeB           QFSWIMPGTIKE--NIIFGVSYDEYRYRSVIKACQLEEDISKFA-------------------EKDNIVL
2pzeA           QFSWIMPGTIKE--NIIFGVSYDEYRYRSVIKACQLEEDISKFA-------------------EKDNIVL
2pzgA           QFSWIMPGTIKE--NIIFGVSYDEYRYRSVIKACQLEEDISKFA-------------------EKDNIVL
2bbsA           -ISFCSQNSWIMIKENIIGVSYDEYRYRSVIKACQLEEDISKFA---------------------EKDNI
2pzfB           QFSWIMP---GTIKENIIGVSYDEYRYRSVIKACQLEEDISKFA-------------------EKDNIVL
1r10A           QFSWIMPGTIKE--NIIFGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1r0zD           QFSWIMPGTIKE--NIIFGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1r0zC           QFSWIMPGTIKE--NIIFGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1r0zB           QFSWIMPGTIKE--NIIFGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1r0zA           QFSWIMPGTIKE--NIIFGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1r0xD           QFSWIMPGTIKE--NIIFGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1r0xC           QFSWIMPGTIKE--NIIFGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1r0xB           QFSWIMPGTIKE--NIIFGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1r0xA           QFSWIMPGTIKE--NIIFGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1r0wC           QFSWIMPGTIKE--NIIFGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1r0wB           QFSWIMPGTIKE--NIIFGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1r0wA           QFSWIMPGTIKE--NIIFGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1q3hD           QFSWIMPGTIKE--NIIFGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1q3hC           QFSWIMPGTIKE--NIIFGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1q3hB           QFSWIMPGTIKE--NIIFGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1q3hA           QFSWIMPGTIKE--NIIFGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
2bbtB           -ISFCSQNSWIMIKENIIGVSYDEYRYRSVIKACQLEEDISKFA-------------------EKDNIVL
2pzfA           QFSWIMP---GTIKENIIGVSYDEYRYRSVIKACQLEEDISKFA-------------------EKDNIVL
2cbzA           QQAWIQNDSLCQLEEPYYRSVIQACALLPDLEILPS----------------------------GDRTEI
2ihyB           PGKV---GYSAETVRQHIGFVFQEGERVIDVVISGAFKSIGVYQDI--DDEIRNEAHQLLKLVGSAKAQQ
2bboA           QFSWIMPGTIKE--NIIFGVSYDEYRYRSVIKACQLEEDISKFA-------------------EKDNIVL
1xmiE           QFSWIMPGTIKE--NIIAGVSYDEYRYRSVIKACQLEEDISKFA-------------------EKDNIVL
1xmiC           QFSWIMPGTIKE--NIIAGVSYDEYRYRSVIKACQLEEDISKFA-------------------EKDNIVL
1xmiA           QFSWIMPGTIKE--NIIAGVSYDEYRYRSVIKACQLEEDISKFA-------------------EKDNIVL
1xmjA           QFSWIMP---GTIKENIIGVSYDEYRYRSVIKACQLEEDISKFA-------------------EKDNIVL
3bk7A           LTVAYKPQ---YIKAEYEGTV---YELLSKIDSSK-------------LNSNFYKTELLKPLGIIDLYDR
1xfaA           QFSWIMPGTIKEIR----GVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1xf9D           QFSWIMPGTIKE--NIISGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1xf9C           QFSWIMPGTIKE--NIISGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1xf9B           QFSWIMPGTIKE--NIISGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
1xf9A           QFSWIMPGTIKE--NIISGVSYDEYRYKSVVKACQLQQDITKFA-----------------EQDNTVLGE
2nq2C           ---------------QSIGFVPQAYSVLDIVLMGRSTHINTFAKPKSHDYQVAMQALDYLNLTHLAKREF
1xmiB           QFSWIMPGTIKE--NIIAGVSYDEYRYRSVIKACQ----------------------------LEEDISK
2nq2D           ---------------QSIGFVPQAYSVLDIVLMGRSTHINTFAKPKSHDYQVAMQALDYLNLTHLAKREF
3b60A           D---LREYTLASLRNQ-VALVSQNVHLFND-TVANNIAYARTYSREQIEEAARMAYAMDFINKMDNGLDT
2vf8B           ------------------------------------------------------------------RLGQ
2vf8A           ------------------------------------------------------------------RLGQ
2vf7C           ------------------------------------------------------------------RLGQ
2vf7B           ------------------------------------------------------------------RLGQ
2vf7A           ------------------------------------------------------------------RLGQ
1z2rA           D---LREYTLASLRNQ-VALVSQNVHLFND-TVANNIAYARTYSREQIEEAARMAYAMDFINKMDNGLDT
2zu0C           DLLALSPEDRA---GEGIFMAFQ-----------YPVEIPGV-SNQFFLQTALNAVRSYRGQETLDRFDF
2d3wA           DLLALSPEDRA---GEGIFMAFQ-----------YPVEIPGV-SNQFFLQTALNAVRSYRGQETLDRFDF
2awoD           RMNDTPP---------------------------------------------------------------
2awnD           RMNDTPP---------------------------------------------------------------
2ghiD           NVNKYNRNSI----RSIIGIVPQDTILFN-----ETIKYNILYGKLDATDEEVIKATKSAQLY--DFIEA
2d3wD           DLLALSPEDRA---GEGIFMAFQ-----------YPVEIPGV-SNQFFLQTALNAVRSYRGQETLDRFDF
2d3wB           DLLALSPEDRA---GEGIFMAFQ-----------YPVEIPGV-SNQFFLQTALNAVRSYRGQETLDRFDF
2r6fB           ------------------------------------------------------------------KLGQ
2r6fA           ------------------------------------------------------------------KLGQ
2qi9C           PLEAWSATKLA-LHRAYLSFATPVWHYLTHQHDKTRTELLNDVAGALAL---------------DDKLGR
1ji0A           DIT----NKPAHVINRGIALVPEGRRIFPELTVYEN--LGAYNRKDKEGIKRDLEWIFSLFPRLKERLKQ
2d3wC           DLLALSPE--------------------------------------------------------------
1l7vC           PLEAWSATKLA-LHRAYLSFATPVWHYLTHQHDKTRTELLNDVAGALAL---------------DDKLGR
2ix3A           EVYTHENCRIAYIKQHAFA------HIESHL----------------------------------EMIAM
2iwhB           EVYTHENCRIAYIKQHAFA------HIESHL----------------------------------EMIAM
2d2fA           NILELSPDERA---RKGLFLAFQYPVEVPGVTIANFLRL-ALQAGVAEFWTKVKKALELLDWDESYLSRY
2d2eA           NILELSPDERA---RKGLFLAFQ-YPVVPGVTIANFLRL-ALQAKLGREVGVAEFWTKVKKAL--ELLDW
1sgwA           PITKVK------------GKIF---FLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEIMDALESVEVKK
2pjzA           EV------------RKIRNYIRYSTNLPEAYEIGVTVDIVYLYEELKGLDRDLFLEMLKALKLGEEILRR
2ix8A           EVYTHENCRIAYIKQHAFA------HIESHL---------------------------------------
2iw3B           EVYTHENCRIAYIKQHAFA------HIESHL---------------------------------------
2iw3A           EVYTHENCRIAYIKQHAFA------HIESHL---------------------------------------
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
1w2hB           SVATL-----------------------------------------------------------------
1w2hA           SVATL-----------------------------------------------------------------
1n5lB           SVATL-----------------------------------------------------------------
1n5lA           SVATL-----------------------------------------------------------------
1n5kB           SVATL-----------------------------------------------------------------
1n5kA           SVATL-----------------------------------------------------------------
1g3uA           SVATL-----------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQA
1l2tB           KPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEGKTVVVVTHDINVARFG
1l2tA           KPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEGKTVVVVTHDINVARFG
1f3oA           KPNQLSGGQQQRVAIARALANNPPIILADEPTGALDSKTGEKIQLLKKLNEEDGKTVVVVTHDINVARFG
2pcjA           KPYELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVMVTHERELAELT
3dhwC           YPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRGLTILLITHEDVVKRIC
3ftjA           ----------------------------------------------------------------------
2it1B           YPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLKELGITTVYVTHDQAEAAMA
2it1A           YPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLKELGITTVYVTHDQAEAAMA
2oukB           YPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREG
2oljA           YPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREG
1b0uA           KPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHS
3fh6A           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVEATLA
2awoA           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVEATLA
2awnB           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVEATLA
1q12A           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVEATLA
2r6gB           KPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVEATLA
2r6gA           KPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVEATLA
3g60A           RGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKARE-GRTTIVIAHRLSTVRNA
3g5uA           RGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKARE-GRTTIVIAHRLSTVRNA
3d31A           NPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKTVLHITHDQTEAIMA
1oxvA           FPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRGVTLLVVSHDPAIFAIA
1oxsC           FPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRGVTLLVVSHDPAIFAIA
2yyzA           KPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQELGITSVYVTHDQAEATMA
1z47B           FPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEGVTSVFVTHDQEEALEA
1z47A           FPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEGVTSVFVTHDQEEALEA
1g291           KPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLRQLGVTTIYVTHDQVEATMG
1mt0A           QGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI-CKGRTVIIIAHRLSTVKNA
2ff7A           QGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI-CKGRTVIIIAHRLSTVKNA
2fgkA           QGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKI-CKGRTVIIIAHRLSTVKNA
2ffbA           QGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKI-CKGRTVIIIAHRLSTVKNA
3b5jA           QGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI-CKGRTVIIIAHRLSTVKNA
2awoC           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVEATLA
1pf4A           VIGELSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQ-KNKTVLVIAHRLSTIEQA
2awnC           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVEATLA
1xefA           QGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI-CKGRTVIIIAARLSTVKNA
2ffaA           QGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI-CKGRTVIIIAARLSTVKNA
2hydA           RGVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLES-ESIIQEALDVLSKDRTTLIVAHRLSTITHA
1jj7A           AGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERSRSVLLITQHLSLVEQA
3fvqB           YPHELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREMIAALRANGKSAVFVSHDREEALQA
3fvqA           YPHELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREMIAALRANGKSAVFVSHDREEALQA
1mv5D           MPDQLSGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLM-KGRTTLVIAHRLSTIVDA
1mv5A           MPDQLSGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLM-KGRTTLVIAHRLSTIVDA
2ixfD           TGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEASRTVLLITHQLSLAERA
2ixfC           TGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEASRTVLLITHQLSLAERA
2ixfA           TGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEASRTVLLITHQLSLAERA
2onkA           KPARLSGGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVREFDVPILHVTHDLIEAAMA
1oxxK           FPRELSGXXXXXXXXXXXXXKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRGVTLLVVSHDPAIFAIA
2d62A           KPRELSGGQRQRVALGRAIIRRPKVFL-DEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHDQ-VEATG
2ixeA           TGNQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEASRTVLLITQQLSLAERA
2ixeD           ---QLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEASRTVLLITQQLSLAERA
1g6hA           KAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRDIVLNYI
2yz2B           VPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDETVINHV
2yz2A           VPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDETVINHV
1gajA           KAGELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRDIVLNYI
2ghiA           KGMKLSGGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLR-KNRTLIIIAHRLSTISSA
1g9xA           KAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRDIVLNYI
2ixgA           TGNQLAVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEASRTVLLITQQLSLAERA
1vplA           RVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLVEFLC
3gfoA           PTHCLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQ-------------------
2ihyA           -IGYLSTGEKQRV-IARAL-GQPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLIYVTHIEEITANF
2ghiC           IVGGMKLGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLR-KNRTLIIIAHRLSTISSA
2bbtA           GGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
2bbsB           GGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
1v43A           YPAQLSGGXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKKVTTIYVTHDQVEATMG
2awnA           RVNQVA----EVLAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVEATLA
1yqtA           EVNELSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKNEKTALVVEHDVLIDYVS
1xmiD           GEITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
2pzgB           GIT-LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
2ghiB           NKMKLSGGERQRIAIARCLLKDPKIVIFDEATS--DSKTEYLFQKAVEDLR-KNRTLIIIAHRTI--SSA
2pzeB           GEGTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
2pzeA           GEGTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
2pzgA           GEGTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
2bbsA           VLITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
2pzfB           GEGTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
1r10A           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1r0zD           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1r0zC           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1r0zB           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1r0zA           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1r0xD           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1r0xC           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1r0xB           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1r0xA           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1r0wC           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1r0wB           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1r0wA           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1q3hD           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1q3hC           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1q3hB           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1q3hA           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
2bbtB           GIT-LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
2pzfA           GEGTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
2cbzA           GEKNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGENVIGPKGMLKNK--TRILVTHSMSYLPQV
2ihyB           YIGYLSTGEKQRV-IARAL-GQPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLIYVTHIEEITANF
2bboA           GEGTLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
1xmiE           GEGTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
1xmiC           GEGTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
1xmiA           GEGTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
1xmjA           GEGTLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
3bk7A           NVEDLSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNETALVVEHDVLMIDYV
1xfaA           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1xf9D           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1xf9C           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1xf9B           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
1xf9A           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKA
2nq2C           --TSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLQSQNMTVVFTTHQP------
1xmiB           IVLTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
2nq2D           --TSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLQSQNMTVVFTTHQP------
3b60A           IIGELSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQ-KNRTSLVIAH--------
2vf8B           PATELSGGEAQRIKLATELRRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAAS
2vf8A           PATELSGGEAQRIKLATELRRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAAS
2vf7C           PATELSGGEAQRIKLATELRRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAAS
2vf7B           PATELSGGEAQRIKLATELRRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAAS
2vf7A           PATELSGGEAQRIKLATELRRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAAS
1z2rA           IIGELSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQ-KNRTSLVIAH--------
2zu0C           QPEDLSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILIKP
2d3wA           QPEDLSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILIKP
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2ghiD           LPKKLSGGERQRIAIARCLLKDPKIVIFDD----------SKTEYLFQKAVEDNRTLIIIAHRLSTISSA
2d3wD           QPEDLSGGEKKRNDILQMAVLEPELCILDESDG-LDIDALKVVADGVNSLRDGKRSFIIVTHYQRILIKP
2d3wB           QPEDLSGGEKKRNDILQMAVLEPELCILDE-SDSLDIDALKVVADGVNSLRDGKRSFIIVTHYRILYIKP
2r6fB           PATTLSGGEAQRVKLAAELSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIKTA
2r6fA           PATTLSGGEAQRVKLAAELSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIKTA
2qi9C           STNQLSGGEWQRVRLAAVVLQAGQLLLLDEP-NSLDVAQQSALDKILSALSQQG-LAIVSSHD-------
1ji0A           LGGTLSGGEQQ-LAIGRAL---SRPKLLDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKA
2d3wC           ----------------------------------------------------------------------
1l7vC           STNQLSGGEWQRVRLAAVVLQAGQLLLLDEP-NSLDVAQQSALDKILSALCQQG-LAIVSSHD-------
2ix3A           PISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSITISHD-------
2iwhB           PISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSITISHD-------
2d2fA           LNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILIQP
2d2eA           DESYLSEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILIQP
1sgwA           KLGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLSILEILKEKGIVII------------
2pjzA           KLYKLSAGQSVLVRTSLALASQPEIVGLDEPFENVDAARRH---VISRYIKEYGKEGILVTHE-------
2ix8A           PISALSGGWK-KLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSITISHD-------
2iw3B           PISALSGGWK-KLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSITISHD-------
2iw3A           PISALSGGWK-KLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSITISHD-------
1ii8B           PLTFLSGGERIALGLAMSLYLAGEILILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAA
1f2uD           PLTFLSGGERIALGLAMSLYLAGEILILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAA
1f2uB           PLTFLSGGERIALGLAMSLYLAGEILILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAA
1f2tB           PLTFLSGGERIALGLAMSLYLAGEILILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAA
1w2hB           ----------------------------------------------------------------------
1w2hA           ----------------------------------------------------------------------
1n5lB           ----------------------------------------------------------------------
1n5lA           ----------------------------------------------------------------------
1n5kB           ----------------------------------------------------------------------
1n5kA           ----------------------------------------------------------------------
1g3uA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ERIIEIHDGKIVHNPPAEEKKREQGVDAAVVNTAPGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l2tB           ERIIYLKDGEV----EREEKLR------------------------------------------------
1l2tA           ERIIYLKDGEV----EREEKLR------------------------------------------------
1f3oA           ERIIYLKDGEV----EREEKLR------------------------------------------------
2pcjA           HRTLEMKDGKVV----------------------------------------------------------
3dhwC           DCVAVISNGELIEQDTVSE---------------------------------------------------
3ftjA           ----------------------------------------------------------------------
2it1B           DRIAVIREGEIL----------------------------------------------------------
2it1A           DRIAVIREGEIL----------------------------------------------------------
2oukB           DRVLFMDGGYIIEEGKPED---------------------------------------------------
2oljA           DRVLFMDGGYIIEEGKPED---------------------------------------------------
1b0uA           SHVIFLHQGKIEEEGDPEQ---------------------------------------------------
3fh6A           DKIVVLDAGRV-----------------------------------------------------------
2awoA           DKIVVLDAGRV-----------------------------------------------------------
2awnB           DKIVVLDAGRV-----------------------------------------------------------
1q12A           DKIVVLDAGRV-----------------------------------------------------------
2r6gB           DKIVVLDAGRV-----------------------------------------------------------
2r6gA           DKIVVLDAGRV-----------------------------------------------------------
3g60A           DVIAGFDGGVIVEQGNHDELMREKGIYFKLVMT-------------------------------------
3g5uA           DVIAGFDGGVIVEQGNHDELMREKGIYFKLVMT-------------------------------------
3d31A           DRIAVVMDGKLIQVGKPEE---------------------------------------------------
1oxvA           DR--------------------------------------------------------------------
1oxsC           DR--------------------------------------------------------------------
2yyzA           SRIAVFNQGKLVQYGTPDE---------------------------------------------------
1z47B           DRVLVLHEGNVEQFGTPEEVYEKPG---------------------------------------------
1z47A           DRVLVLHEGNVEQFGTPEEVYEKPG---------------------------------------------
1g291           DRIAVMNRG-------------------------------------------------------------
1mt0A           DRIIVMEKGKIV----------------------------------------------------------
2ff7A           DRIIVMEKGKIV----------------------------------------------------------
2fgkA           DRIIVMEKGKIV----------------------------------------------------------
2ffbA           DRIIVMEKGKIV----------------------------------------------------------
3b5jA           DRIIVMEKGKIV----------------------------------------------------------
2awoC           DKIVVLDAGRV-----------------------------------------------------------
1pf4A           DEILVVDEGEII----------------------------------------------------------
2awnC           DKIVVLDAGRV-----------------------------------------------------------
1xefA           DRIIVMEKGKIV----------------------------------------------------------
2ffaA           DRIIVMEKGKIV----------------------------------------------------------
2hydA           DKIVVIENGHIVETGTHRELIAKQG---------------------------------------------
1jj7A           DHILFLEGGAIREGGTHQQLMEKKGCYWAMV---------------------------------------
3fvqB           DRIAVMKQGRILQTSPHELYRQPADLDAAL----------------------------------------
3fvqA           DRIAVMKQGRILQTSPHELYRQPADLDAAL----------------------------------------
1mv5D           DKIYFIEKGQI-----------------------------------------------------------
1mv5A           DKIYFIEKGQI-----------------------------------------------------------
2ixfD           HHILFLKEGSV-----------------------------------------------------------
2ixfC           HHILFLKEGSV-----------------------------------------------------------
2ixfA           HHILFLKEGSV-----------------------------------------------------------
2onkA           DEVAVMLNGRIVEKGKLKE---------------------------------------------------
1oxxK           DR--------------------------------------------------------------------
2d62A           DRI-------------------------------------------------------------------
2ixeA           HHILFLKEGSV-----------------------------------------------------------
2ixeD           HHILFLKEGSV-----------------------------------------------------------
1g6hA           DHLYVMFNGQIIAEGRGEEEIKNVLSDPKVV---------------------------------------
2yz2B           DRVVVLEKGKKV----------------------------------------------------------
2yz2A           DRVVVLEKGKKV----------------------------------------------------------
1gajA           DHLYVMFNGQIIAEGRGEEEIKNVLSDPKVV---------------------------------------
2ghiA           ESIILLNKGKIVEKGTHKDLLKLNGEYAEMWNMQSG----------------------------------
1g9xA           DHLYVMFNGQIIAEGRGEEEIKNVLSDPKVV---------------------------------------
2ixgA           HHILFLKEGSV-----------------------------------------------------------
1vplA           DRIALIHNGTIVETGTVEELK-------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2ihyA           SKILLLKDGQSIQQGAVED---------------------------------------------------
2ghiC           ESIILLNKGKIVEKGTHKDLLKLNGEYAEMWN--------------------------------------
2bbtA           DKILILHEG-------------------------------------------------------------
2bbsB           DKILILHEG-------------------------------------------------------------
1v43A           DRIAVMNRGQLLQGSPTEVYLRPNSVFVATFIGAP-----------------------------------
2awnA           DKIVVLDAGRV-----------------------------------------------------------
1yqtA           DRLVEGEPGKYGRAPPGREGNR------------------------------------------------
1xmiD           DKILILHEG-------------------------------------------------------------
2pzgB           DKILILHEG-------------------------------------------------------------
2ghiB           ESIILLNKGKIVEKGTHKDLLKLNGEYAEMWN--------------------------------------
2pzeB           DKILILHEG-------------------------------------------------------------
2pzeA           DKILILHEG-------------------------------------------------------------
2pzgA           DKILILHEG-------------------------------------------------------------
2bbsA           DKILILHEG-------------------------------------------------------------
2pzfB           DKILILHEG-------------------------------------------------------------
1r10A           DKILILHQG-------------------------------------------------------------
1r0zD           DKILILHQG-------------------------------------------------------------
1r0zC           DKILILHQG-------------------------------------------------------------
1r0zB           DKILILHQG-------------------------------------------------------------
1r0zA           DKILILHQG-------------------------------------------------------------
1r0xD           DKILILHQG-------------------------------------------------------------
1r0xC           DKILILHQG-------------------------------------------------------------
1r0xB           DKILILHQG-------------------------------------------------------------
1r0xA           DKILILHQG-------------------------------------------------------------
1r0wC           DKILILHQG-------------------------------------------------------------
1r0wB           DKILILHQG-------------------------------------------------------------
1r0wA           DKILILHQG-------------------------------------------------------------
1q3hD           DKILILHQG-------------------------------------------------------------
1q3hC           DKILILHQG-------------------------------------------------------------
1q3hB           DKILILHQG-------------------------------------------------------------
1q3hA           DKILILHQG-------------------------------------------------------------
2bbtB           DKILILHEG-------------------------------------------------------------
2pzfA           DKILILHEG-------------------------------------------------------------
2cbzA           DVIIVMSGGKISEMGSYQELLARDGAFAEFLRT-------------------------------------
2ihyB           SKILLLKDGQSIQQGAVED---------------------------------------------------
2bboA           DKILILHEG-------------------------------------------------------------
1xmiE           DKILILHEG-------------------------------------------------------------
1xmiC           DKILILHEG-------------------------------------------------------------
1xmiA           DKILILHEG-------------------------------------------------------------
1xmjA           DKILILHEG-------------------------------------------------------------
3bk7A           SDRLIVFEGE------------------------------------------------------------
1xfaA           DKILILHQG-------------------------------------------------------------
1xf9D           DKILILHQG-------------------------------------------------------------
1xf9C           DKILILHQG-------------------------------------------------------------
1xf9B           DKILILHQG-------------------------------------------------------------
1xf9A           DKILILHQG-------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1xmiB           DKILILHEG-------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2vf8B           DWVLDIGPGAVAQGTPAEVAQAAGSVTAPYLRAA------------------------------------
2vf8A           DWVLDIGPGAVAQGTPAEVAQAAGSVTAPYLRAA------------------------------------
2vf7C           DWVLDIGPGAVAQGTPAEVAQAAGSVTAPYLRAA------------------------------------
2vf7B           DWVLDIGPGAVAQGTPAEVAQAAGSVTAPYLRAA------------------------------------
2vf7A           DWVLDIGPGAVAQGTPAEVAQAAGSVTAPYLRAA------------------------------------
1z2rA           ----------------------------------------------------------------------
2zu0C           DYVHVLYQGRIV----------------------------------------------------------
2d3wA           DYVHVLYQGRIV----------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2ghiD           ESIILLNKGKIVEKGTHKDLLKLNGEYAEMWN--------------------------------------
2d3wD           DYVHVLYQGRIV----------------------------------------------------------
2d3wB           DYVHVLYQGRIV----------------------------------------------------------
2r6fB           DYIIDL----------------------------------------------------------------
2r6fA           DYIIDL----------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1ji0A           HYGYVLETGQIVLEGKASE---------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2d2fA           DKVHVMMDGRVV----------------------------------------------------------
2d2eA           DKVHVMMDGRVV----------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
1ii8B           DHVIRI----------------------------------------------------------------
1f2uD           DHVIRI----------------------------------------------------------------
1f2uB           DHVIRI----------------------------------------------------------------
1f2tB           DHVIRI----------------------------------------------------------------
1w2hB           ----------------------------------------------------------------------
1w2hA           ----------------------------------------------------------------------
1n5lB           ----------------------------------------------------------------------
1n5lA           ----------------------------------------------------------------------
1n5kB           ----------------------------------------------------------------------
1n5kA           ----------------------------------------------------------------------
1g3uA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxQMVLADIRAMGTNTIDIHPGKDFGDDNPQYRQALKYDDLVAIQKQLWVNSATP
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3ftjA           -----------------QKILENIRGIGTNTMTIFNGNGFGDRRSRHIQNLKISDANTLSKQSYIQSVTP
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
1w2hB           ----------------------------------------------------------------------
1w2hA           ----------------------------------------------------------------------
1n5lB           ----------------------------------------------------------------------
1n5lA           ----------------------------------------------------------------------
1n5kB           ----------------------------------------------------------------------
1n5kA           ----------------------------------------------------------------------
1g3uA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SVSKSLRLRYGNIDIAVNANGVSGDYFNVYGMSFREGNTFNXXXXXXXXXXXXXXANTRRQLFPNKANVV
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3ftjA           NTSSSGILVVGNKSFSANLYGIGEQYFDVEGLKLKQGRLLTEDDVDQSNQVVVLDESAKKAIFANE-NPL
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
1w2hB           ----------------------------------------------------------------------
1w2hA           ----------------------------------------------------------------------
1n5lB           ----------------------------------------------------------------------
1n5lA           ----------------------------------------------------------------------
1n5kB           ----------------------------------------------------------------------
1n5kA           ----------------------------------------------------------------------
1g3uA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GEVVLVGNMPVIVIGVAEEKPSMYGNSNLLQVWLPYSTMSDRIMGQSWLNSITVRVKDGVDSDQAEQQLT
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3ftjA           GKTVIFNKRPFRVIGVVSDQS--------LNLYSPYSTVLNKITGGSRIGSITVKISDDVNSTVAEKSLT
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
1w2hB           ----------------------------------------------------------------------
1w2hA           ----------------------------------------------------------------------
1n5lB           ----------------------------------------------------------------------
1n5lA           ----------------------------------------------------------------------
1n5kB           ----------------------------------------------------------------------
1n5kA           ----------------------------------------------------------------------
1g3uA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RLLTLRHGKKDFFTWNMDSVLKTAEKTTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3ftjA           ELLKSLHGKKDFFIMNSDTIKQTIENTT------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
1w2hB           ----------------------------------------------------------------------
1w2hA           ----------------------------------------------------------------------
1n5lB           ----------------------------------------------------------------------
1n5lA           ----------------------------------------------------------------------
1n5kB           ----------------------------------------------------------------------
1n5kA           ----------------------------------------------------------------------
1g3uA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3ftjA           ----------------------------------------------------------------------
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2qi9C           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
1w2hB           ----------------------------------------------------------------------
1w2hA           ----------------------------------------------------------------------
1n5lB           ----------------------------------------------------------------------
1n5lA           ----------------------------------------------------------------------
1n5kB           ----------------------------------------------------------------------
1n5kA           ----------------------------------------------------------------------
1g3uA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxx
1l2tB           ------------------
1l2tA           ------------------
1f3oA           ------------------
2pcjA           ------------------
3dhwC           ------------------
3ftjA           ------------------
2it1B           ------------------
2it1A           ------------------
2oukB           ------------------
2oljA           ------------------
1b0uA           ------------------
3fh6A           ------------------
2awoA           ------------------
2awnB           ------------------
1q12A           ------------------
2r6gB           ------------------
2r6gA           ------------------
3g60A           ------------------
3g5uA           ------------------
3d31A           ------------------
1oxvA           ------------------
1oxsC           ------------------
2yyzA           ------------------
1z47B           ------------------
1z47A           ------------------
1g291           ------------------
1mt0A           ------------------
2ff7A           ------------------
2fgkA           ------------------
2ffbA           ------------------
3b5jA           ------------------
2awoC           ------------------
1pf4A           ------------------
2awnC           ------------------
1xefA           ------------------
2ffaA           ------------------
2hydA           ------------------
1jj7A           ------------------
3fvqB           ------------------
3fvqA           ------------------
1mv5D           ------------------
1mv5A           ------------------
2ixfD           ------------------
2ixfC           ------------------
2ixfA           ------------------
2onkA           ------------------
1oxxK           ------------------
2d62A           ------------------
2ixeA           ------------------
2ixeD           ------------------
1g6hA           ------------------
2yz2B           ------------------
2yz2A           ------------------
1gajA           ------------------
2ghiA           ------------------
1g9xA           ------------------
2ixgA           ------------------
1vplA           ------------------
3gfoA           ------------------
2ihyA           ------------------
2ghiC           ------------------
2bbtA           ------------------
2bbsB           ------------------
1v43A           ------------------
2awnA           ------------------
1yqtA           ------------------
1xmiD           ------------------
2pzgB           ------------------
2ghiB           ------------------
2pzeB           ------------------
2pzeA           ------------------
2pzgA           ------------------
2bbsA           ------------------
2pzfB           ------------------
1r10A           ------------------
1r0zD           ------------------
1r0zC           ------------------
1r0zB           ------------------
1r0zA           ------------------
1r0xD           ------------------
1r0xC           ------------------
1r0xB           ------------------
1r0xA           ------------------
1r0wC           ------------------
1r0wB           ------------------
1r0wA           ------------------
1q3hD           ------------------
1q3hC           ------------------
1q3hB           ------------------
1q3hA           ------------------
2bbtB           ------------------
2pzfA           ------------------
2cbzA           ------------------
2ihyB           ------------------
2bboA           ------------------
1xmiE           ------------------
1xmiC           ------------------
1xmiA           ------------------
1xmjA           ------------------
3bk7A           ------------------
1xfaA           ------------------
1xf9D           ------------------
1xf9C           ------------------
1xf9B           ------------------
1xf9A           ------------------
2nq2C           ------------------
1xmiB           ------------------
2nq2D           ------------------
3b60A           ------------------
2vf8B           ------------------
2vf8A           ------------------
2vf7C           ------------------
2vf7B           ------------------
2vf7A           ------------------
1z2rA           ------------------
2zu0C           ------------------
2d3wA           ------------------
2awoD           ------------------
2awnD           ------------------
2ghiD           ------------------
2d3wD           ------------------
2d3wB           ------------------
2r6fB           ------------------
2r6fA           ------------------
2qi9C           ------------------
1ji0A           ------------------
2d3wC           ------------------
1l7vC           ------------------
2ix3A           ------------------
2iwhB           ------------------
2d2fA           ------------------
2d2eA           ------------------
1sgwA           ------------------
2pjzA           ------------------
2ix8A           ------------------
2iw3B           ------------------
2iw3A           ------------------
1ii8B           ------------------
1f2uD           ------------------
1f2uB           ------------------
1f2tB           ------------------
1w2hB           ------------------
1w2hA           ------------------
1n5lB           ------------------
1n5lA           ------------------
1n5kB           ------------------
1n5kA           ------------------
1g3uA           ------------------