[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF69636.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vp5A.bssp"
#ERROR : Can't open dsspfile "1vp5B.bssp"
#ERROR : Can't open dsspfile "3f7jA.bssp"
#ERROR : Can't open dsspfile "3d3fA.bssp"
#ERROR : Can't open dsspfile "1vbjB.bssp"
#ERROR : Can't open dsspfile "1vbjA.bssp"
#ERROR : Can't open dsspfile "3b3dB.bssp"
#ERROR : Can't open dsspfile "3b3dA.bssp"
#ERROR : Can't open dsspfile "1mzrB.bssp"
#ERROR : Can't open dsspfile "1mzrA.bssp"
#ERROR : Can't open dsspfile "1zgdA.bssp"
#ERROR : Can't open dsspfile "3caqB.bssp"
#ERROR : Can't open dsspfile "3burA.bssp"
#ERROR : Can't open dsspfile "3h7rA.bssp"
#ERROR : Can't open dsspfile "1a80A.bssp"
#ERROR : Can't open dsspfile "1qwkA.bssp"
#ERROR : Can't open dsspfile "3h7uA.bssp"
#ERROR : Can't open dsspfile "1hw6A.bssp"
#ERROR : Can't open dsspfile "1m9hA.bssp"
#ERROR : Can't open dsspfile "1jezA.bssp"
#ERROR : Can't open dsspfile "1j96B.bssp"
#ERROR : Can't open dsspfile "2fgbA.bssp"
#ERROR : Can't open dsspfile "1k8cA.bssp"
#ERROR : Can't open dsspfile "1z9aA.bssp"
#ERROR : Can't open dsspfile "1xjbB.bssp"
#ERROR : Can't open dsspfile "1xjbA.bssp"
#ERROR : Can't open dsspfile "1mi3A.bssp"
#ERROR : Can't open dsspfile "1j96A.bssp"
#ERROR : Can't open dsspfile "1ihiA.bssp"
#ERROR : Can't open dsspfile "1xf0A.bssp"
#ERROR : Can't open dsspfile "1jezB.bssp"
#ERROR : Can't open dsspfile "1ye4A.bssp"
#ERROR : Can't open dsspfile "1zq5A.bssp"
#ERROR : Can't open dsspfile "1sm9A.bssp"
#ERROR : Can't open dsspfile "2ipjA.bssp"
#ERROR : Can't open dsspfile "1mrqA.bssp"
#ERROR : Can't open dsspfile "3c3uA.bssp"
#ERROR : Can't open dsspfile "1s1rA.bssp"
#ERROR : Can't open dsspfile "1s1pA.bssp"
#ERROR : Can't open dsspfile "1ry0A.bssp"
#ERROR : Can't open dsspfile "1zuaX.bssp"
#ERROR : Can't open dsspfile "1r38A.bssp"
#ERROR : Can't open dsspfile "2fvlA.bssp"
#ERROR : Can't open dsspfile "3h4gA.bssp"
#ERROR : Can't open dsspfile "3cv7A.bssp"
#ERROR : Can't open dsspfile "2ao0A.bssp"
#ERROR : Can't open dsspfile "1hqtA.bssp"
#ERROR : Can't open dsspfile "3cv6A.bssp"
#ERROR : Can't open dsspfile "1q13B.bssp"
#ERROR : Can't open dsspfile "1q5mA.bssp"
#ERROR : Can't open dsspfile "2he5C.bssp"
#ERROR : Can't open dsspfile "2he8A.bssp"
#ERROR : Can't open dsspfile "2p5nA.bssp"
#ERROR : Can't open dsspfile "2hejA.bssp"
#ERROR : Can't open dsspfile "2he8B.bssp"
#ERROR : Can't open dsspfile "2ipgA.bssp"
#ERROR : Can't open dsspfile "2bgsA.bssp"
#ERROR : Can't open dsspfile "1frbA.bssp"
#ERROR : Can't open dsspfile "1c9wA.bssp"
#ERROR : Can't open dsspfile "2ipwA.bssp"
#ERROR : Can't open dsspfile "2alrA.bssp"
#ERROR : Can't open dsspfile "2bgqA.bssp"
#ERROR : Can't open dsspfile "1az1A.bssp"
#ERROR : Can't open dsspfile "1ah3A.bssp"
#ERROR : Can't open dsspfile "1ah0A.bssp"
#ERROR : Can't open dsspfile "2i16A.bssp"
#ERROR : Can't open dsspfile "1z8aA.bssp"
#ERROR : Can't open dsspfile "1us0A.bssp"
#ERROR : Can't open dsspfile "1pwmA.bssp"
#ERROR : Can't open dsspfile "2pdyA.bssp"
#ERROR : Can't open dsspfile "2pdxA.bssp"
#ERROR : Can't open dsspfile "2pdqA.bssp"
#ERROR : Can't open dsspfile "2pdmA.bssp"
#ERROR : Can't open dsspfile "2pdkA.bssp"
#ERROR : Can't open dsspfile "2pdiA.bssp"
#ERROR : Can't open dsspfile "2pdhA.bssp"
#ERROR : Can't open dsspfile "2pdfA.bssp"
#ERROR : Can't open dsspfile "2pdbA.bssp"
#ERROR : Can't open dsspfile "2is7A.bssp"
#ERROR : Can't open dsspfile "2ikiA.bssp"
#ERROR : Can't open dsspfile "1el3A.bssp"
#ERROR : Can't open dsspfile "2dv0A.bssp"
#ERROR : Can't open dsspfile "2agtA.bssp"
#ERROR : Can't open dsspfile "1adsA.bssp"
#ERROR : Can't open dsspfile "2acsA.bssp"
#ERROR : Can't open dsspfile "2pd5A.bssp"
#ERROR : Can't open dsspfile "1afsA.bssp"
#ERROR : Can't open dsspfile "2acuA.bssp"
#ERROR : Can't open dsspfile "1xgdA.bssp"
#ERROR : Can't open dsspfile "1ralA.bssp"
#ERROR : Can't open dsspfile "1lwiA.bssp"
#ERROR : Can't open dsspfile "1pyfA.bssp"
#ERROR : Can't open dsspfile "1og6C.bssp"
#ERROR : Can't open dsspfile "1og6A.bssp"
#ERROR : Can't open dsspfile "1ynqA.bssp"
#ERROR : Can't open dsspfile "1pz1A.bssp"
#ERROR : Can't open dsspfile "1ynpA.bssp"
#ERROR : Can't open dsspfile "3erpB.bssp"
#ERROR : Can't open dsspfile "1ynpB.bssp"
#ERROR : Can't open dsspfile "1og6B.bssp"
#ERROR : Can't open dsspfile "1ur3M.bssp"
#ERROR : Can't open dsspfile "3erpA.bssp"
#ERROR : Can't open dsspfile "2bp1B.bssp"
#ERROR : Can't open dsspfile "2c91B.bssp"
#ERROR : Can't open dsspfile "2c91A.bssp"
#ERROR : Can't open dsspfile "2bp1A.bssp"
#ERROR : Can't open dsspfile "2clpI.bssp"
#ERROR : Can't open dsspfile "2clpA.bssp"
#ERROR : Can't open dsspfile "1gveA.bssp"
#ERROR : Can't open dsspfile "1gveB.bssp"
#ERROR : Can't open dsspfile "1lqaA.bssp"
#ERROR : Can't open dsspfile "1zsxA.bssp"

## Summary of PDB Search
:289
    1e-73  47%  1vp5A  [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
    2e-73  47%  1vp5B  [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
    7e-61  48%  3f7jA  [x.x.x] YVGN PROTEIN
    7e-61  48%  3d3fA  [x.x.x] YVGN PROTEIN
    3e-58  46%  1vbjB  [x.x.x] PROSTAGLANDIN F SYNTHASE
    3e-58  46%  1vbjA  [x.x.x] PROSTAGLANDIN F SYNTHASE
    1e-57  44%  3b3dB  [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE
    1e-57  44%  3b3dA  [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE
    1e-51  42%  1mzrB  [c.1.7] 2,5-DIKETO-D-GLUCONATE REDUCTASE A
    1e-51  42%  1mzrA  [c.1.7] 2,5-DIKETO-D-GLUCONATE REDUCTASE A
    4e-49  42%  1zgdA  [x.x.x] CHALCONE REDUCTASE
    3e-48  44%  3caqB  [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE
    3e-48  44%  3burA  [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE
    3e-47  42%  3h7rA  [x.x.x] ALDO-KETO REDUCTASE
    1e-45  39%  1a80A  [x.x.x] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
    2e-45  42%  1qwkA  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1
    2e-45  41%  3h7uA  [x.x.x] ALDO-KETO REDUCTASE
    2e-44  40%  1hw6A  [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
    6e-44  38%  1m9hA  [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
    8e-44  44%  1jezA  [c.1.7] XYLOSE REDUCTASE
    8e-44  40%  1j96B  [c.1.7] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE TYPE 3
    1e-43  40%  2fgbA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    2e-43  43%  1k8cA  [c.1.7] XYLOSE REDUCTASE
    3e-43  43%  1z9aA  [x.x.x] NAD(P)H-DEPENDENT D-XYLOSE REDUCTASE
    3e-43  40%  1xjbB  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C2
    3e-43  40%  1xjbA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C2
    3e-43  43%  1mi3A  [c.1.7] XYLOSE REDUCTASE
    3e-43  40%  1j96A  [c.1.7] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE TYPE 3
    3e-43  40%  1ihiA  [c.1.7] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    4e-43  40%  1xf0A  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    4e-43  43%  1jezB  [c.1.7] XYLOSE REDUCTASE
    7e-43  43%  1ye4A  [x.x.x] NAD(P)H-DEPENDENT D-XYLOSE REDUCTASE
    9e-43  40%  1zq5A  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    9e-43  43%  1sm9A  [c.1.7] XYLOSE REDUCTASE
    1e-42  40%  2ipjA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C2
    1e-42  40%  1mrqA  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1
    1e-42  40%  3c3uA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1
    2e-42  40%  1s1rA  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    2e-42  40%  1s1pA  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    2e-42  40%  1ry0A  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    3e-42  41%  1zuaX  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER B10
    4e-42  43%  1r38A  [c.1.7] XYLOSE REDUCTASE
    3e-41  39%  2fvlA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C4
    1e-40  38%  3h4gA  [x.x.x] ALCOHOL DEHYDROGENASE [NADP+]
    1e-40  38%  3cv7A  [x.x.x] ALCOHOL DEHYDROGENASE
    1e-40  38%  2ao0A  [x.x.x] ALDEHYDE DEHYDROGENASE
    2e-40  38%  1hqtA  [c.1.7] ALDEHYDE REDUCTASE
    9e-40  36%  3cv6A  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C21
    3e-39  37%  1q13B  [c.1.7] PROSTAGLANDIN-E2 9-REDUCTASE
    4e-39  37%  1q5mA  [c.1.7] PROSTAGLANDIN-E2 9-REDUCTASE
    4e-39  36%  2he5C  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
    6e-39  36%  2he8A  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
    1e-38  35%  2p5nA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
    1e-38  35%  2hejA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
    1e-38  35%  2he8B  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
    6e-38  35%  2ipgA  [x.x.x] 3(17)ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-37  34%  2bgsA  [x.x.x] ALDOSE REDUCTASE
    4e-37  37%  1frbA  [x.x.x] FR-1 PROTEIN
    2e-36  38%  1c9wA  [c.1.7] CHO REDUCTASE
    2e-36  37%  2ipwA  [x.x.x] ALDOSE REDUCTASE
    2e-36  36%  2alrA  [x.x.x] ALDEHYDE REDUCTASE
    6e-36  36%  2bgqA  [x.x.x] ALDOSE REDUCTASE
    7e-35  37%  1az1A  [x.x.x] ALDOSE REDUCTASE
    1e-34  37%  1ah3A  [c.1.7 (1ekoA)] ALDOSE REDUCTASE
    1e-34  37%  1ah0A  [x.x.x] ALDOSE REDUCTASE
    1e-34  37%  2i16A  [x.x.x] ALDOSE REDUCTASE
    2e-34  37%  1z8aA  [x.x.x] ALDOSE REDUCTASE
    2e-34  37%  1us0A  [c.1.7] ALDOSE REDUCTASE
    2e-34  37%  1pwmA  [c.1.7] ALDOSE REDUCTASE
    2e-34  37%  2pdyA  [x.x.x] ALDOSE REDUCTASE
    2e-34  37%  2pdxA  [x.x.x] ALDOSE REDUCTASE
    2e-34  37%  2pdqA  [x.x.x] ALDOSE REDUCTASE
    2e-34  37%  2pdmA  [x.x.x] ALDOSE REDUCTASE
    2e-34  37%  2pdkA  [x.x.x] ALDOSE REDUCTASE
    2e-34  37%  2pdiA  [x.x.x] ALDOSE REDUCTASE
    2e-34  37%  2pdhA  [x.x.x] ALDOSE REDUCTASE
    2e-34  37%  2pdfA  [x.x.x] ALDOSE REDUCTASE
    2e-34  37%  2pdbA  [x.x.x] ALDOSE REDUCTASE
    2e-34  37%  2is7A  [x.x.x] ALDOSE REDUCTASE
    2e-34  37%  2ikiA  [x.x.x] ALDOSE REDUCTASE
    2e-34  37%  1el3A  [c.1.7] ALDOSE REDUCTASE
    2e-34  37%  2dv0A  [x.x.x] ALDOSE REDUCTASE
    2e-34  37%  2agtA  [x.x.x] ALDOSE REDUCTASE
    2e-34  37%  1adsA  [c.1.7 (1ef3A)] ALDOSE REDUCTASE
    2e-34  37%  2acsA  [x.x.x] ALDOSE REDUCTASE
    3e-34  36%  2pd5A  [x.x.x] ALDOSE REDUCTASE
    3e-34  35%  1afsA  [c.1.7] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    7e-34  36%  2acuA  [x.x.x] ALDOSE REDUCTASE
    1e-33  36%  1xgdA  [x.x.x] ALDOSE REDUCTASE
    1e-33  36%  1ralA  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    4e-33  35%  1lwiA  [c.1.7] 3-ALPHA-HYDROXYSTEROID/DIHYDRODIOL DEHYDROGENASE
    2e-12  29%  1pyfA  [c.1.7] IOLS PROTEIN
    9e-11  28%  1og6C  [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF
    9e-11  28%  1og6A  [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF
    6e-10  27%  1ynqA  [x.x.x] OXIDOREDUCTASE
    7e-10  35%  1pz1A  [c.1.7] GENERAL STRESS PROTEIN 69
    7e-08  27%  1ynpA  [x.x.x] OXIDOREDUCTASE
    9e-08  26%  3erpB  [x.x.x] PUTATIVE OXIDOREDUCTASE
    1e-07  28%  1ynpB  [x.x.x] OXIDOREDUCTASE
    1e-07  26%  1og6B  [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF
    2e-07  32%  1ur3M  [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF
    1e-06  25%  3erpA  [x.x.x] PUTATIVE OXIDOREDUCTASE
    3e-06  26%  2bp1B  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    7e-06  26%  2c91B  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    7e-06  26%  2c91A  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    1e-05  27%  2bp1A  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    3e-05  29%  2clpI  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
    3e-05  29%  2clpA  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
    4e-05  27%  1gveA  [c.1.7] AFLATOXIN B1 ALDEHYDE REDUCTASE
    7e-05  27%  1gveB  [c.1.7] AFLATOXIN B1 ALDEHYDE REDUCTASE
    5e-04  32%  1lqaA  [c.1.7] TAS PROTEIN
    6e-04  26%  1zsxA  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL BETA-2 SUBUNIT
:289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xEYSILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCTR
1vp5A           -----LNNGVEMPILGYGVFQIPP-EKTEECVYEAIKVGYRLIDTAASYMNEEGVGRAIKRAIDEGIVRR
1vp5B           -----LNNGVEMPILGYGVFQIPP-EKTEECVYEAIKVGYRLIDTAASYMNEEGVGRAIKRAIDEGIVRR
3f7jA           -----LHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVA----R
3d3fA           -----LHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVA----R
1vbjB           -----LSNGVMMPVLGFGMWKLQDGNEAETATMWAIKSGYRHIDTAAIYKNEESAG----RAIASCGVPR
1vbjA           -----LSNGVMMPVLGFGMWKLQDGNEAETATMWAIKSGYRHIDTAAIYKNEESAG----RAIASCGVPR
3b3dB           -----LHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNXXXXXXXXXXXXXXXXXXX
3b3dA           -----LHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNXXXXXXXXXXXXXXXXXXX
1mzrB           -----------MPQLGLGVWQASN-EEVITAIQKALEVGYRSIDTAAAYKNEEGVGKALKNASVN----R
1mzrA           -----------MPQLGLGVWQASN-EEVITAIQKALEVGYRSIDTAAAYKNEEGVGKALKNASVN----R
1zgdA           ------SSQLKMPVVGMGSAPFTCKKDTKDAIIEAIKQGYRHFDTAAAYGSEQALGEALKEAIELGLVTR
3caqB           -----LSDGNSIPIIGLGTYKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRR
3burA           -----LSDGNSIPIIGLGTYKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRR
3h7rA           -----LNTGAKLPCVGLGTYAMV-----ATAIEQAIKIGYRHIDCASIYGNEKEIGGVLKKLIGDGFVKR
1a80A           ----VLNDGNSIPQLGYGVFKVPPADT-QRAVEEALEVGYRHIDTAAIYGNEEGVXXXXXXXXXX----R
1qwkA           -----LSNGVEMPVIGLGTWQ-SSPAEVITAVKTAVKAGYRLIDTASVYQNEEAIGTAIKELLEEGVVKR
3h7uA           -----LNTGAKFPSVGLGTWQASPGL-VGDAVAAAVKIGYRHIDCAQIYGNEKEIGAVLKKLFEDRVVKR
1hw6A           ----VLNDGNSIPQLGYGVFKVPPADT-QRAVEEALEVGYRHIDTAAIYGNEEGVXXXXXXXXXX----R
1m9hA           ----VLNDGNSIPQLGYGVYKVPPADT-QRAVEEALEVGYRHIDTAAIYGNEEGVXXXXXXXXXX----R
1jezA           -----LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKR
1j96B           -----------MPVLGFGTYAPAEKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKR
2fgbA           -----------MPVLGFGTYAPPERSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKR
1k8cA           -----LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKR
1z9aA           -----LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKR
1xjbB           -----------MPVLGFGTYAPAEKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKR
1xjbA           -----------MPVLGFGTYAPAEKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKR
1mi3A           -----LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKR
1j96A           -----------MPVLGFGTYAPAEKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKR
1ihiA           -----------MPVLGFGTYAPAEKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKR
1xf0A           -----------MPVLGFGTYAPPESKALEVTKL-AIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKR
1jezB           -----LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKR
1ye4A           -----LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKR
1zq5A           -----------MPVLGFGTYAPPERSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKR
1sm9A           -----LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKR
2ipjA           -----------MPVLGFGTAAPAEKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKR
1mrqA           -----------MPVLGFGTYAPAEKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKR
3c3uA           -----------MPVLGFGTYAPAEKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKR
1s1rA           -----------MPVLGFGTYAPPERSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKR
1s1pA           -----------MPVLGFGTYAPPERSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKR
1ry0A           -----------MPVLGFGTYAPPERSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKR
1zuaX           -----LSTKAKMPIVGLGTWK-SPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKIQEKAVKR
1r38A           -----LSSGHLMPSIGFGCWKLANATAGEQ-VYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKR
2fvlA           -----------MPVLGFGTYAPPERNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRSKIADGSVKR
3h4gA           ----LLHTGQKMPLIGLGTWK-SEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAVR
3cv7A           ----LLHTGQKMPLIGLGTWK-SEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAVR
2ao0A           ----LLHTGQKMPLIGLGTWK-SEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAVR
1hqtA           ----LLHTGQKMPLIGLGTWK-SEPGQVKAAIKYALTVGYRHIDCAAIFGNELEIGEALQETVGPGKAVR
3cv6A           ----ILNDGNFIPVLGFGTALPLEKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSKIADGTVRR
1q13B           -----LSDGHFIPVLGFGTYAPEEKSKAMEATKIAIDAGFRHIDSAYFYKNEKEVGLAIRSKIADGTVKR
1q5mA           -----LSDGHFIPVLGFGTYAPEEKSKAMEATKIAIDAGFRHIDSAYFYKNEKEVGLAIRSKIADGTVKR
2he5C           ----ILNDGNFIPVLGFGTALPLEKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSKIADGTVRR
2he8A           ----ILNDGNFIPVLGFGTALPLEKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSKIADGTVRR
2p5nA           ----ILNDGNFIPVLGFGTALPLEKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSKIADGTVRR
2hejA           ----ILNDGNFIPVLGFGTALPLEKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSKIADGTVRR
2he8B           ----ILNDGNFIPVLGFGTALPLEKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSKIADGTVRR
2ipgA           ----ILNDGNFIPVLGFGTALPLECPASKAKELTAIDAGFHHFDSASVYNTEDHVGEAIRSKIADGTVRR
2bgsA           -DHFVLKSGHAMPAVGLGTWRAGS--DTAHSVRTAIEAGYRHVDTAAEYGVEKEVGKGLKAAMEAGI-DR
1frbA           -----LSTKAKMPIVGLGTWK-SPPNQVKEAVKAAIDAGYRHIDCAYAYCNENEVGEAIQEKIKEKAVQR
1c9wA           -----LSTKAKMPIVGLGTWQ-SPPGQVKEAVKVAIDAGYRHIDCAYAYYNEHEVGEAIQEKIKEKAVRR
2ipwA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2alrA           ----LLHTGQKMPLIGLGTWK-SEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVR
2bgqA           -DHFVLKSGHAMPAVGLGTW------DTAHSVRTAIEAGYRHVDTAAEYGVEKEVGKGLKAAMEAGI-DR
1az1A           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
1ah3A           ----VLYTGAKMPILGLGTWK-SPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKLQGQVVKR
1ah0A           ----VLYTGAKMPILGLGTWK-SPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKLQGQVVKR
2i16A           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
1z8aA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
1us0A           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
1pwmA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2pdyA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2pdxA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2pdqA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2pdmA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2pdkA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2pdiA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2pdhA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2pdfA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2pdbA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2is7A           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2ikiA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
1el3A           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2dv0A           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2agtA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
1adsA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2acsA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2pd5A           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHIYQNENEVGVAIQEKLREQVVKR
1afsA           -----------IPVLGFGVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVKR
2acuA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVHQNENEVGVAIQEKLREQVVKR
1xgdA           ----LLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
1ralA           -----------IPVLGFGVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVKR
1lwiA           -----------IPVLGFGT-TVPAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVKR
1pyfA           ---------------GHNLYPNLNEETGKELVREAIRNGVTL-DTAYIYGSEELIGEVLREF------NR
1og6C           -----------------GYWRLMDWNMSARQLVSFIEEGVTTVDHADIYGGEAAFGEALKLAPHL----R
1og6A           -----------------GYWRLMDWNMSARQLVSFIEEGVTTVDHADIYGGEAAFGEALKLAPHL----R
1ynqA           ------TSDLHVSELGFGCMSLTDETKARRIMDEVLELGINYLDTADLYNNEQFVGKALKGR-------R
1pz1A           -----------------------DEKTSIETIRAALDQGITLIDTAPAYGSEEIVGKAIKEY------KR
1ynpA           ------TSDLHVSELGFGCMSLTDETKARRIMDEVLELGINYLDTADLYNNEQFVGKALKGR-------R
3erpB           -------SGVKLPAISLGLFGDTTRVENSRALLQAFDLGITHFDLANNYGPPPGSAECNFGRILQELPWR
1ynpB           ------TSDLHVSELGFGCMSLTDETKARRIMDEVLELGINYLDTADLYNNEQFVGKALKGRLATKVGNR
1og6B           -----------------GYWRLMDWNMSARQLVSFIEEGVTTVDHADIYGGEAAFGEALKLAPHL----R
1ur3M           --------------------------------------GVTTVDHADIYGGEAAFGEALK--LAPHLRER
3erpA           -------SGVKLPAISLGLFGDTTRVENSRALLQAFDLGITHFDLANNYGPPPGSAECNFGRILQELPWR
2bp1B           ------------------------------AVRAFLERGHTELDTAFMYS--DGQSETIXXXXXXXXXCR
2c91B           -----------------------DASASAASVRAFLERGHSELDTAFMYGQSENIXXXXXXXXXXXDCT-
2c91A           -----------------------DASASAASVRAFLERGHSELDTAFMYGQSENIXXXXXXXXXXXDCT-
2bp1A           ------------------------------AVRAFLERGHTELDTAFMYGQSETIXXXXXXXXXXXDC-R
2clpI           -----------------------------------LERGHTEIDTAFVYGQSETIXXXXXXXXXXSDC-R
2clpA           -----------------------------------LERGHTEIDTAFVYGQSETIXXXXXXXXXXSDC-R
1gveA           -----------------------DVTSSSRSVRAFLQRGHTEIDTAFVYGQSETIXXXXXXXXXRSGCKV
1gveB           -----------------------DVTSSSASVRAFLQRGHTEIDTAFVYGQSETIXXXXXXXXXRSGCKV
1lqaA           --HRIPHSSLEVSTLGLGTMTFGEQNDAHAQLDYAVAQGINLIDVAEMYPTETYVGNWLAKH-----GSR
1zsxA           -------SGLRVSCLGLGTWQITD-EMAEQLMTLAYDNGINLFDTAEVYAAEVVLGNIIKKK----GWRR


                         .         .         *         .         .         .         .:140
query           EELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFSAWRALEDAYEAGKLKAIGVS
1vp5A           EELFVTTKLWVSDVG-YESTKKAFEKSLKKLQLEYIDLYLIHQPFGDVHCAWKAMEEMYKDGLVRAIGVS
1vp5B           EELFVTTKLWVSDVG-YESTKKAFEKSLKKLQLEYIDLYLIHQPFGDVHCAWKAMEEMYKDGLVRAIGVS
3f7jA           EELFITSKVWNEDQG-YETTLAAFEKSLERLQLDYLDLYLIHWPGKDYKDTWRALEKLYKDGKIRAIGVS
3d3fA           EELFITSKVWNEDQG-YETTLAAFEKSLERLQLDYLDLYLIHWPGKDYKDTWRALEKLYKDGKIRAIGVS
1vbjB           EELFVTTKLWNSDQG-YESTLSAFEKSIKKLGLEYVDLYLIHWPGKDKFDTWKAFEKLYADKKVRAIGVS
1vbjA           EELFVTTKLWNSDQG-YESTLSAFEKSIKKLGLEYVDLYLIHWPGKDKFDTWKAFEKLYADKKVRAIGVS
3b3dB           XDLFITSKVWNADLG-YEETLAAFETSLSKLGLDYLDLYLIHWPVGKYKEAWRALETLYKEGRIKAIGVS
3b3dA           XDLFITSKVWNADLG-YEETLAAFETSLSKLGLDYLDLYLIHWPVGKYKEAWRALETLYKEGRIKAIGVS
1mzrB           EELFITTKLWNDD---HKRPREALLDSLKKLQLDYIDLYLMHPAIDHYVEAWKGMIELQKEGLIKSIGVC
1mzrA           EELFITTKLWNDD---HKRPREALLDSLKKLQLDYIDLYLMHPAIDHYVEAWKGMIELQKEGLIKSIGVC
1zgdA           DDLFVTSKLWVTENHPH-LVIPALQKSLKTLQLDYLDLYLIHWPLSDVKGVWESMEESLKLGLTKAIGVS
3caqB           EDIFYCGKLWATNHVP-EMVRPTLERTLRVLQLDYVDLYIIEVPMGDEIATWEAMEACKDAGLVKSLGVS
3burA           EDIFYCGKLWATNHVP-EMVRPTLERTLRVLQLDYVDLYIIEVPMGDEIATWEAMEACKDAGLVKSLGVS
3h7rA           EELFITSKLWSNDHLPEDVPKA-LEKTLQDLQIDYVDLYLIHWPASDITSTWKAMEALYDSGKARAIGVS
1a80A           DDLFITTKLW-NDRHDGDEPXXXXXXXXXXXXXDQVDLYLVHPAADNYVHAWEKMIELRAAGLTRSIGVS
1qwkA           EELFITTKAWTHELAPGKL-EGGLRESLKKLQLEYVDLYLAHMAFNDDMSVWRQFDAVYKAGLAKAVGVS
3h7uA           EDLFITSKLWCTDHDPQDVPEA-LNRTLKDLQLEYVDLYLIHWSVGDIPSTWKAMEALYDSGKARAIGVS
1hw6A           DDLFITTKLW------NDEPXXXXXXXXXXXXXDQVDLYLVHPAADNYVHAWEKMIELRAAGLTRSIGVS
1m9hA           DDLFITTKLW-NDRHDGDEPXXXXXXXXXXXXXDQVDLYLVHPAADNYVHAWEKMIELRAAGLTRSIGVS
1jezA           EEIFLTSKLWYHDPKNVETALNKTLADLK---VDYVDLFLIHFPIAFKFETWKALEKLVAAGKIKSIGVS
1j96B           EDIFYTSKLW-SNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSDLCATWEAMEKCKDAGLAKSIGVS
2fgbA           EDIFYTSKLW-STFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSDLCTTWEAMEKCKDAGLAKSIGVS
1k8cA           EEIFLTSKLWYHDPKNVETALNKTLADLK---VDYVDLFLIHFPIAFKFETWKALEKLVAAGKIKSIGVS
1z9aA           EEIFLTSKLWYHDPKNVETALNKTLADLK---VDYVDLFLIHFPIAFKFETWKALEKLVAAGKIKSIGVS
1xjbB           EDIFYTSKLW-SNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSDLCATWEAMEKCKDAGLAKSIGVS
1xjbA           EDIFYTSKLW-SNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSDLCATWEAMEKCKDAGLAKSIGVS
1mi3A           EEIFLTSKLWYHDPKNVETALNKTLADLK---VDYVDLFLIHFPIAFKFETWKALEKLVAAGKIKSIGVS
1j96A           EDIFYTSKLW-SNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSDLCATWEAMEKCKDAGLAKSIGVS
1ihiA           EDIFYTSKLW-SNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSDLCATWEAMEKCKDAGLAKSIGVS
1xf0A           EDIFYTSKLW-STFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSDLCTTWEAMEKCKDAGLAKSIGVS
1jezB           EEIFLTSKLWYHDPKNVETALNKTLADLK---VDYVDLFLIHFPIAFKFETWKALEKLVAAGKIKSIGVS
1ye4A           EEIFLTSKLWYHDPKNVETALNKTLADLK---VDYVDLFLIHFPIAFKFETWKALEKLVAAGKIKSIGVS
1zq5A           EDIFYTSKLW-STFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSDLCTTWEAMEKCKDAGLAKSIGVS
1sm9A           EEIFLTSKLWYHDPKNVETALNKTLADLK---VDYVDLFLIHFPIAFKFETWKALEKLVAAGKIKSIGVS
2ipjA           EDIFYTSKLW-SNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSDLCATWEAMEKCKDAGLAKSIGVS
1mrqA           EDIFYTSKLWC-NSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSDLCATWEAVEKCKDAGLAKSIGVS
3c3uA           EDIFYTSKLWC-NSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSDLCATWEAVEKCKDAGLAKSIGVS
1s1rA           EDIFYTSKLW-STFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSDLCTTWEAMEKCKDAGLAKSIGVS
1s1pA           EDIFYTSKLW-STFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSDLCTTWEAMEKCKDAGLAKSIGVS
1ry0A           EDIFYTSKLW-STFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSDLCTTWEAMEKCKDAGLAKSIGVS
1zuaX           EDLFIVSKLW-PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGTFLDAWEAMEELVDEGLVKALGVS
1r38A           EEIFLTSKLWYHDPKNVETALNKTLADLK---VDYVDLFLIAFPIAFKFETWKALEKLVAAGKIKSIGVS
2fvlA           EDIFYTSKLWCT-FFQPQMVQPALESSLKKLQLDYVDLYLLHFPMADLSATWEVMEKCKDAGLAKSIGVS
3h4gA           EELFVTSKLWNTKHHPEDVEPA-LRKTLADLQLEYLDLYLMHWPYGDYKDTWKALEALVAKGLVRALGLS
3cv7A           EELFVTSKLWNTKHHPEDVEPA-LRKTLADLQLEYLDLYLMHWPYGDYKDTWKALEALVAKGLVRALGLS
2ao0A           EELFVTSKLWNTKHHPEDVEPA-LRKTLADLQLEYLDLYLMHWPYGDYKDTWKALEALVAKGLVRALGLS
1hqtA           EELFVTSKLWNTKHHPEDVEPA-LRKTLADLQLEYLDLYLMHWPYGDYKDTWKALEALVAKGLVRALGLS
3cv6A           EDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMADLCATWEAMEKCKDAGLTKSIGVS
1q13B           EDIFYTSKLWCT-FHRPELVRPSLEDSLKNLQLDYVDLYIIHFPTADICATWEAMEKCKDAGLAKSIGVS
1q5mA           EDIFYTSKLWCT-FHRPELVRPSLEDSLKNLQLDYVDLYIIHFPTADICATWEAMEKCKDAGLAKSIGVS
2he5C           EDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMADLCATWEAMEKCKDAGLTKSIGVS
2he8A           EDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMADLCATWEAMEKCKDAGLTKSIGVS
2p5nA           EDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMADLCATWEAMEKCKDAGLTKSIGVS
2hejA           EDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMADLCATWEAMEKCKDAGLTKSIGVS
2he8B           EDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMADLCATWEAMEKCKDAGLTKSIGVS
2ipgA           EDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMADLCATWEAMEKCKDAGLTKSIGVS
2bgsA           KDLFVTSKIWCTNLAP-ERVRPALENTLKDLQLDYIDLYHIHWPFRDMEGVWKEMENLVKDGLVKDIGVC
1frbA           EDLFIVSKLWPTCFEK-KLLKEAFQXXXXXXXXXXXXXXXIHWPQGTFLEAWEGMEELVDQGLVKALGVS
1c9wA           EDLFIVSKLWPTCFER-KLLKEAFQXXXXXXXXXXXXXXXIHWPQGTFLDAWEVMEELVDEGLVKALGVS
2ipwA           EELFIVSKLWCT-YHEKGLVKGACQKTXXKPGKEFFPLDNVVPSDTNILDTWAAMEELVDEGLVKAIGIS
2alrA           EELFVTSKLWNTKHHPEDVEPA-LRKTLADLQLEYLDLYLMHWPYGDYKETWKALEALVAKGLVQALGLS
2bgqA           KDLFVTSKIWCTNLAP-ERVRPALENTLKDLQLDYIDLYHIHWPFRDMEGVWKEMENLVKDGLVKDIGVC
1az1A           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
1ah3A           EDLFIVSKLWCTDHEK-NLVKGACQTTXXXXXXXXXXXXXIHWPTGDFVETWEAMEELVDEGLVKAIGVS
1ah0A           EDLFIVSKLWCTDHEK-NLVKGACQTTXXXXXXXXXXXXXIHWPTGDFVETWEAMEELVDEGLVKAIGVS
2i16A           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
1z8aA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
1us0A           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
1pwmA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
2pdyA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
2pdxA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
2pdqA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
2pdmA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
2pdkA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
2pdiA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
2pdhA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
2pdfA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
2pdbA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
2is7A           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
2ikiA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
1el3A           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
2dv0A           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
2agtA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
1adsA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
2acsA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
2pd5A           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
1afsA           EDIFYTSKLW-STFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMGDIFDTWEAMEKCKDAGLAKSIGVS
2acuA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
1xgdA           EELFIVSKLWCT-YHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGNILDTWAAMEELVDEGLVKAIGIS
1ralA           EDIFYTSKLW-STFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMGDIFDTWEAMEKCKDAGLAKSIGVS
1lwiA           EDIFYTSKLW-STFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMGDIFDTWEAMEKCKDAGLAKSIGVS
1pyfA           EDVVIATKAAHRKQGNDDFLKKSVDESLKRLNTDYIDLFYIHDEHTPKDEAVNALNEK-KAGKIRSIGVS
1og6C           ERMEIVSKCGIATTADRDHIIKSAEQSLINLATDHLDLLLIHRPLMDADEVADAFKHLHQSGKVRHFGVS
1og6A           ERMEIVSKCGIATTADRDHIIKSAEQSLINLATDHLDLLLIHRPLMDADEVADAFKHLHQSGKVRHFGVS
1ynqA           QDIILATKVWWWDPSKAYIKEA-VKDSLRRLQTDYIDLYQLHGGTIDIDETIEAFEELKQEGVIRYYGIS
1pz1A           DQVILATKTWKNNQANRARIVEEVENSLKRLQTDYIDLYQVHWPDPLVIEETAEVKELYDAGKIRAIGVS
1ynpA           QDIILATKV------SKAYIKEAVKDSLRRLQTDYIDLYQLHGGTIDIDETIEAFEELKQEGVIRYYGIS
3erpB           DELIISTKMWDGPYGDWGSRKASLDQSLKRMGLEYVDIFYHHRPDPELKETMKALDHLVRHGKALYVGIS
1ynpB           FEQGKEGWWWDPSKA---YIKEAVKDSLRRLQTDYIDLYQLHGGTIDIDETIEAFEELKQEGVIRYYGIS
1og6B           ERMEIVSKCGIATTADRDHIIKSAEQSLINLATDHLDLLLIHRPLMDADEVADAFKHLHQSGKVRHFGVS
1ur3M           E---IVSKCGIATTADRDHIIKSAEQSLINLATDHLDLLLIHRPDPDADEVADAFKHLHQSGKVRHFGVS
3erpA           DELIISTKMWDGPYGDWGSRKASLDQSLKRMGLEYVDIFYHHRPDPELKETMKALDHLVRHGKALYVGIS
2bp1B           VKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAP--DHGTTLHACQRLHQEGKFVELGLS
2c91B           VKIATKANPWEGKSLKPDSIRSQLETSLKRLQCPRVDLFYLHAP--DHSTPVEACHQLHQEGKFVELGLS
2c91A           VKIATKANPWEGKSLKPDSIRSQLETSLKRLQCPRVDLFYLHAP--DHSTPVEACHQLHQEGKFVELGLS
2bp1A           VKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAP--DHGTTLHACQRLHQEGKFVELGLS
2clpI           VKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLH--MPDHSTTLRACHQLHQEGKFVELGLS
2clpA           VKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLH--MPDHSTTLRACHQLHQEGKFVELGLS
1gveA           KIATKAAPMFGKTLKPADV-RFQLETSLKRLQCPRVDLFYLH--FPDHGTTLQACHQLHQEGKFVELGLS
1gveB           KIATKAAPMFGKTLKPADV-RFQLETSLKRLQCPRVDLFYLH--FPDHGTTLQACHQLHQEGKFVELGLS
1lqaA           EKLIIASKVSGPSRNNDDQAREALHDSLKRLQTDYLDLYQVHNCFGKLGYSWTALAEYQRAGKIRYIGVS
1zsxA           SSLVITTKIFWGGKAETERGLSGLKASLERLQLEYVDVVFANRPDPNMEETVRAMTHVINQGMAMYWGTS


                         +         .         .         .         .         *         .:210
query           NFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPYENVMLQRIADA
1vp5A           NFYPDRLMDLMVHHEIVPAVNQIEIHPFYQRQEEIEFMRNYNIQPEAWGPFAEGRKNIFQNGVLRSIAEK
1vp5B           NFYPDRLMDLMVHHEIVPAVNQIEIHPFYQRQEEIEFMRNYNIQPEAWGPFAEGRKNIFQNGVLRSIAEK
3f7jA           NFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPLMQG--QLLDNEVLTQIAEK
3d3fA           NFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPLMQG--QLLDNEVLTQIAEK
1vbjB           NFHEHHIEELLKHCKVAPMVNQIELHPLLNQKALCEYCKSKNIAVTAWSPLGQGH--LVEDARLKAIGGK
1vbjA           NFHEHHIEELLKHCKVAPMVNQIELHPLLNQKALCEYCKSKNIAVTAWSPLGQGH--LVEDARLKAIGGK
3b3dB           NFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQG--QLLDHPVLADIAQT
3b3dA           NFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQG--QLLDHPVLADIAQT
1mzrB           NFQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHAWNATHKIQTESWSPLAQGGKGVFDQKVIRDLADK
1mzrA           NFQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHAWNATHKIQTESWSPLAQGGKGVFDQKVIRDLADK
1zgdA           NFSVKKLENLLSVATVLPAVNQVEMNLAWQQKKLREFCNAHGIVLTAFSPVSRGPNEVMENDMLKEIADA
3caqB           NFNRRQLELILNKLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVLLNSLGKR
3burA           NFNRRQLELILNKLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVLLNSLGKR
3h7rA           NFSSKKLTDLLNVARVTPAVNQVECHPVWQQQGLHELCKSKGVHLSGYSPLGSQRLKVLQNPIVTEVAEK
1a80A           NHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTXXXXX
1qwkA           NWNNDQISR-ALALGLTPVHNQVELHLYFPQHDHVDFCKKHNISVTSYATLGSGRPSDLQDQNVLALAEK
3h7uA           NFSTKKLADLLELARVPPAVNQVECHPSWRQTKLQEFCKSKGVHLSAYSPLGSPKSDVLKNPILNMVAEK
1hw6A           NHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTXXXXX
1m9hA           NHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTXXXXX
1jezA           NFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSTL-------FAHDTIKAIAAK
1j96B           NFNHRLLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWEDPVLCALAKK
2fgbA           NFNRRQLEMILNKLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWEDPVLCALAKK
1k8cA           NFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTPQSFVNQGRALNTPFAHDTIKAIAAK
1z9aA           NFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTPQSFVEMNQGRNTPFAHDTIKAIAAK
1xjbB           NFNHRLLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWEDPVLCALAKK
1xjbA           NFNHRLLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWEDPVLCALAKK
1mi3A           NFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTPQSFVEMNQGRNTPFAHDTIKAIAAK
1j96A           NFNHRLLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWEDPVLCALAKK
1ihiA           NFNHRLLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWEDPVLCALAKK
1xf0A           NFNRRQLEMILNKLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWEDPVLCALAKK
1jezB           NFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSF------LFAHDTIKAIAAK
1ye4A           NFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTPQSFVEMNQGRNTPFAHDTIKAIAAK
1zq5A           NFNRRQLEMILNKLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWEDPVLCALAKK
1sm9A           NFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTPQSFVEMNQGRNTPFAHDTIKAIAAK
2ipjA           NFNHRLLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWEDPVLCALAKK
1mrqA           NFNRRQLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWEDPVLCALAKK
3c3uA           NFNRRQLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWEDPVLCALAKK
1s1rA           NFNRRQLEMILNKLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWEDPVLCALAKK
1s1pA           NFNRRQLEMILNKLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWEDPVLCALAKK
1ry0A           NFNRRQLEMILNKLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWEDPVLCALAKK
1zuaX           NFSHFQIEKLLNKLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRKPLEDPKIKEIAAK
1r38A           NFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTPQSFVEMNQGRNTPFAHDTIKAIAAK
2fvlA           NFNYRQLEMILNKLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWEDPVLCALAKK
3h4gA           NFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAPNEPVLLQALAEK
3cv7A           NFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAPNEPVLLQALAEK
2ao0A           NFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAPNEPVLLQALAEK
1hqtA           NFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAPNEPVLLQALAEK
3cv6A           NFNYRQLEMILNKLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYPPWDEPVLGSMAKK
1q13B           NFNRRQLEMILNKLKYKPVCNQVECHPYLNQGKLLEFCKSKGIVLVAYSALGSHREPSLEDPLIGALAKK
1q5mA           NFNRRQLEMILNKLKYKPVCNQVECHPYLNQGKLLEFCKSKGIVLVAYSALGSHREPEWEDPLIGALAKK
2he5C           NFNYRQLEMILNKLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTGQNSPLDEPVLGSMAKK
2he8A           NFNYRQLEMILNKLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTGQNSPLDEPVLGSMAKK
2p5nA           NFNYRQLEMILNKLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWDEPVLGSMAKK
2hejA           NFNYRQLEMILNKLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWDEPVLGSMAKK
2he8B           NFNYRQLEMILNKLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWDEPVLGSMAKK
2ipgA           NFNYRQLEMILNKLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWDEPVLGSMAKK
2bgsA           NYTVTKLNRLLRSAKIPPAVCQMEMHPGWKNDKIFEACKKHGIHITAYSPLGSSEKNLAHDPVVEKVANK
1frbA           NFNHFQIERLLNKLKHKPVTNQVECHPYLTQEKLIQYCHSKGISVTAYSPLGSPDRKPLEDPKIKEIAAK
1c9wA           NFNHFQIERILNKLKHKPVTNQVECHPYLTQEKLIEYCHSKGITVTAYSPLGSPNRKPLEDPKIKEIAAK
2ipwA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSP-DRPYEDPRIKAIAAK
2alrA           NFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSXXXXXXXXXXXXXXXXK----
2bgqA           NYTVTKLNRLLRSAKIPPAVCQMEMHPGWKNDKIFEACKKHGIHITAYSPLGKNAHDP----VVEKVANK
1az1A           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSP-DRPYEDPRIKAIAAK
1ah3A           NFNHLQVEKILNKLKYKPAVNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
1ah0A           NFNHLQVEKILNKLKYKPAVNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
2i16A           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
1z8aA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
1us0A           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
1pwmA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
2pdyA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
2pdxA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
2pdqA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
2pdmA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
2pdkA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
2pdiA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
2pdhA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
2pdfA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
2pdbA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
2is7A           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
2ikiA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
1el3A           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
2dv0A           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
2agtA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
1adsA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
2acsA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
2pd5A           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
1afsA           NFNCRQLERILNKLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSSRDKTWDDPVLCAIAKK
2acuA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
1xgdA           NFN-HLQVEMILNLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRKPLEDPRIKAIAAK
1ralA           NFNCRQLERILNKLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSSRDKTWDDPVLCAIAKK
1lwiA           NFNCRQLERILNKLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSDQKSPLDDPVLCAIAKK
1pyfA           NFSLEQLKEANKDGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPLVSGGERFKENIKLAPIAEK
1og6C           NFTPAQFALLQSRLPFTLATNQVEIHXXXXXXXXXXXXXXXRVRPMAWSCLGGGRFQPLRDELAVVAEEL
1og6A           NFTPAQFALLQSRLPFTLATNQVEIHXXXXXXXXXXXXXXXRVRPMAWSCLGGGRFQPLRDELAVVAEEL
1ynqA           SIRPNVIKEYLKRSNIVSIMMQYSI---------------LDRRPEEWFPL-------------------
1pz1A           NF--------------------------------------------------------------------
1ynpA           SIRPNVIKEYLKRSNIVSIMMQYSI---------------LDRRPEEWFPL-------------------
3erpB           NYLARQAIDILEDLGTPCLIHQYSLFERWVEDGLLALLQEKGVGSIAFSPLAGGRYDKLEKVRLNELAAR
1ynpB           SIRPNVIKEYLKRSNIVSIMMQYSI---------------LDRRPEEWFPL-------------------
1og6B           NFTPAQFALLQSRLPFTLATNQVEIHXXXXXXXXXXXXXXXRVRPMAWSLFNDDYFQPLRDELAVVAEEL
1ur3M           NFTPAQFALLQSRLPFTLATNQVEIHXXXXXXXXXXXXXXXRVRP-AWSCLGGGRFQPLRDELAVVAEEL
3erpA           NYLARQAIDILEDLGTPCLIHQYSLFERWVEDGLLALLQEKGVGSIAFSPLAGGQTDRYLNIRLNELAAR
2bp1B           NYASWEVAEICTLCKILPTVYQ---GMYNATTRQVETLRHFGLRFYAYNPLAGG----------------
2c91B           NYASWEVAEICTLCKILPTVYQGMYNATTRQVEALPCLRHFGLRFYAYNPLAGG----------------
2c91A           NYASWEVAEICTLCKILPTVYQGMYNATTRQVEALPCLRHFGLRFYAYNPLAGG----------------
2bp1A           NYASWEVAEICTLCKILPTVYQ---GMYNATTRQVETLRHFGLRFYAYNPLAGG----------------
2clpI           NYAAWEVAEICTLCKILPTVYQ---GMYNAITRQVETLRHFGLRFYAFNPLAGG----------------
2clpA           NYAAWEVAEICTLCKILPTVYQ---GMYNAITRQVETLRHFGLRFYAFNPLAGG----------------
1gveA           NYVSWEVAEICTLCKIMPTVYQ---GMYNAITRQVETLRHFGLRFYAFNPLAGG----------------
1gveB           NYVSWEVAEICTLCKIMPTVYQ---GMYNAITRQVETLRHFGLRFYAFNPLAGG----------------
1lqaA           NRYLH-LADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFG----------------
1zsxA           RWSSMEIMEAYSVARTPPICEQAEYHMFQREKVEVELFHKIGVGAMTWSPLACG----------------


                         .         .         .         +         .         .         .:280
query           HQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGYVGEAVKHFNPEFVR
1vp5A           YGKTVAQVILRWLTQKGIVAIPKTVRRERMKENISIFDFELTQEDMEKIATLDEGQ-SAFFSHRDPEVVK
1vp5B           YGKTVAQVILRWLTQKGIVAIPKTVRRERMKENISIFDFELTQEDMEKIATLDEGQ-SAFFSHRDPEVVK
3f7jA           HNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQEDMDKIDALN-----------------
3d3fA           HNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQEDMDKIDALN-----------------
1vbjB           YGKTAAQVMLRWEIQAGVITIPKSGNEARIKENGNIFDFELTAEDIQVIDGMNAGH--------------
1vbjA           YGKTAAQVMLRWEIQAGVITIPKSGNEARIKENGNIFDFELTAEDIQVIDGMNAGH--------------
3b3dB           YNKSVAQIILRWDLQHGIITIPKSTKEHRIKENASVFDFELTQDDMNRIDALN-----------------
3b3dA           YNKSVAQIILRWDLQHGIITIPKSTKEHRIKENASVFDFELTQDDMNRIDALN-----------------
1mzrB           YGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAENFDVWDFRLDKDELGEIAKLDQG---------------
1mzrA           YGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAENFDVWDFRLDKDELGEIAKLDQG---------------
1zgdA           HGKSVAQISLRWLYEQGVTFVPKSYDKERMNQNLRIFDWSLTKEDHEKI---------------------
3caqB           YNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALN-----------------
3burA           YNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALN-----------------
3h7rA           LGKTTAQVALRWGLQTGHSVLPKSSSGARLKENLDVFDWSIPED--------------------------
1a80A           HGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDPG---------------
1qwkA           THKTPAQVLLRYALDRGCAILPKSIQENRIKENFEVFDFSLTEEDIAKL---------------------
3h7uA           LGKSPAQVALRWGLQMGHSVLPKSTNEGRIKENFNVFDWSIPDYMFAKFAEIE-----------------
1hw6A           HGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMD-----------------
1m9hA           HGKTPAQAVLRWHLQKGFVVFPGSVRREHLEENLDVFDFDLTDTEIAAIDAMDPG---------------
1jezA           YNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIG---------------
1j96B           HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN-----------------
2fgbA           HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD-----------------
1k8cA           YNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIG---------------
1z9aA           YNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIG---------------
1xjbB           HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN-----------------
1xjbA           HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN-----------------
1mi3A           YNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIG---------------
1j96A           HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN-----------------
1ihiA           HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN-----------------
1xf0A           HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD-----------------
1jezB           YNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIG---------------
1ye4A           YNKTPAEVLLRWAAQRGIAVIPRSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIG---------------
1zq5A           HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD-----------------
1sm9A           YNKTPAEVLLRWAAQRGIAVIPRSDLPERLVQNRSFNTFDLTKEDFEEIAKLDIG---------------
2ipjA           HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN-----------------
1mrqA           HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN-----------------
3c3uA           HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN-----------------
1s1rA           HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD-----------------
1s1pA           HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD-----------------
1ry0A           HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD-----------------
1zuaX           HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATI---------------------
1r38A           YNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIG---------------
2fvlA           HKRTPALIALRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLNRNY--------------
3h4gA           YNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALN-----------------
3cv7A           YNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALN-----------------
2ao0A           YNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALN-----------------
1hqtA           YNRSPAQILLRWQVQRKVICIPKSVTPSRIPQNIQVFDFTFSPEEMKQLDALN-----------------
3cv6A           YNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNMRYIPAAIFKGHPNW--
1q13B           HQQTPALIALRYQLQRGIVVLAKSFTEKRIKENIQVFEFQLPSEDMKVIDSLNRNF--------------
1q5mA           HQQTPALIALRYQLQRGIVVLAKSFTEKRIKENIQVFEFQLPSEDMKVIDSLNRNF--------------
2he5C           YNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNMRYIPAAIFKGHPNW--
2he8A           YNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNMRYIPAAIFKGHPNW--
2p5nA           YNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNMRYIPAAIFKGHPNW--
2hejA           YNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNMRYIPAAIFKGHPNW--
2he8B           YNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNMRYIPAAIFKGHPNW--
2ipgA           YNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNMRYIPAAIFKGHPNW--
2bgsA           LNKTPGQVLIKWALQRGTSVIPKSSKDERIKENIQVFGWEIPEED-------------------------
1frbA           HEKTSAQVLIRFHIQRNVVVIPKSVTPSRIQENIQVFDFQLSDEEMATI---------------------
1c9wA           HKKTSAQVLIRFHIQRNVVVIPKSVTPARIHENFQVFDFQLSDQEMATI---------------------
2ipwA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
2alrA           YGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALN-----------------
2bgqA           LNKTPGQVLIKWALQRGTSVIPKSSKDERIKENIQVFGWEIPEED-------------------------
1az1A           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
1ah3A           YNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDM------------------------
1ah0A           YNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDM------------------------
2i16A           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
1z8aA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
1us0A           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
1pwmA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
2pdyA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
2pdxA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
2pdqA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
2pdmA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
2pdkA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
2pdiA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
2pdhA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
2pdfA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
2pdbA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
2is7A           HDKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
2ikiA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
1el3A           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
2dv0A           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
2agtA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
1adsA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
2acsA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
2pd5A           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
1afsA           YKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNAKYFD-----
2acuA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------------
1xgdA           HNKTTAQVLIRFPMQRNLVVIPKSVTPEAIAENFKVFDFELSSQDMTTL---------------------
1ralA           YKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNF--------------
1lwiA           YKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNAKYF------
1pyfA           HNVDIPHIVLAWYLARPEILIPGAKRADQLIDNIKTADVTLSQEDISFIDKL------------------
1og6C           NAGSIEQVVNAWVLRLPSQPLPGSGKIERVRAAVEAETLKMTRQQWFRIRKAALGY--------------
1og6A           NAGSIEQVVNAWVLRLPSQPLPGSGKIERVRAAVEAETLKMTRQQWFRIRKAALGY--------------
1ynqA           ----------------------------------------------------------------------
1pz1A           ----------------------------------------------------------------------
1ynpA           ----------------------------------------------------------------------
3erpB           RGQKLSQMALAWVLRNDTSVLIGASKPSQIED--------------------------------------
1ynpB           ----------------------------------------------------------------------
1og6B           NAGSIEQVVNAWVLRLPSQPLPGSGKIERVRAAVEAETLKMTRQQWFRIRKAALGY--------------
1ur3M           NAGSIEQVVNAW----------------------------------------------------------
3erpA           RGQKLSQMALAWVLRNDTSVLIGASKPSQIED--------------------------------------
2bp1B           ----------------------------------------------------------------------
2c91B           ----------------------------------------------------------------------
2c91A           ----------------------------------------------------------------------
2bp1A           ----------------------------------------------------------------------
2clpI           ----------------------------------------------------------------------
2clpA           ----------------------------------------------------------------------
1gveA           ----------------------------------------------------------------------
1gveB           ----------------------------------------------------------------------
1lqaA           ----------------------------------------------------------------------
1zsxA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GCLGVKxxx
1vp5A           WICSLK---
1vp5B           ---------
3f7jA           ---------
3d3fA           ---------
1vbjB           ---------
1vbjA           ---------
3b3dB           ---------
3b3dA           ---------
1mzrB           ---------
1mzrA           ---------
1zgdA           ---------
3caqB           ---------
3burA           ---------
3h7rA           ---------
1a80A           ---------
1qwkA           ---------
3h7uA           ---------
1hw6A           ---------
1m9hA           ---------
1jezA           ---------
1j96B           ---------
2fgbA           ---------
1k8cA           ---------
1z9aA           ---------
1xjbB           ---------
1xjbA           ---------
1mi3A           ---------
1j96A           ---------
1ihiA           ---------
1xf0A           ---------
1jezB           ---------
1ye4A           ---------
1zq5A           ---------
1sm9A           ---------
2ipjA           ---------
1mrqA           ---------
3c3uA           ---------
1s1rA           ---------
1s1pA           ---------
1ry0A           ---------
1zuaX           ---------
1r38A           ---------
2fvlA           ---------
3h4gA           ---------
3cv7A           ---------
2ao0A           ---------
1hqtA           ---------
3cv6A           ---------
1q13B           ---------
1q5mA           ---------
2he5C           ---------
2he8A           ---------
2p5nA           ---------
2hejA           ---------
2he8B           ---------
2ipgA           ---------
2bgsA           ---------
1frbA           ---------
1c9wA           ---------
2ipwA           ---------
2alrA           ---------
2bgqA           ---------
1az1A           ---------
1ah3A           ---------
1ah0A           ---------
2i16A           ---------
1z8aA           ---------
1us0A           ---------
1pwmA           ---------
2pdyA           ---------
2pdxA           ---------
2pdqA           ---------
2pdmA           ---------
2pdkA           ---------
2pdiA           ---------
2pdhA           ---------
2pdfA           ---------
2pdbA           ---------
2is7A           ---------
2ikiA           ---------
1el3A           ---------
2dv0A           ---------
2agtA           ---------
1adsA           ---------
2acsA           ---------
2pd5A           ---------
1afsA           ---------
2acuA           ---------
1xgdA           ---------
1ralA           ---------
1lwiA           ---------
1pyfA           ---------
1og6C           ---------
1og6A           ---------
1ynqA           ---------
1pz1A           ---------
1ynpA           ---------
3erpB           ---------
1ynpB           ---------
1og6B           ---------
1ur3M           ---------
3erpA           ---------
2bp1B           ---------
2c91B           ---------
2c91A           ---------
2bp1A           ---------
2clpI           ---------
2clpA           ---------
1gveA           ---------
1gveB           ---------
1lqaA           ---------
1zsxA           ---------