[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF69712.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1l0qA.bssp"
#ERROR : Can't open dsspfile "1cwvA.bssp"
#ERROR : Can't open dsspfile "2bq9C.bssp"
#ERROR : Can't open dsspfile "2bq9A.bssp"
#ERROR : Can't open dsspfile "1cwvA.bssp"

## Summary of PDB Search
:3824
    4e-04  29%  1l0qA  [b.69.2 - b.1.3] SURFACE LAYER PROTEIN
    6e-04  26%  1cwvA  [b.1.14 - b.1.14 - b.1.14 - b.1.14 - d.169.1] INVASIN
    7e-04  26%  2bq9C  [x.x.x] BACTERIAL SIALIDASE
    7e-04  26%  2bq9A  [x.x.x] BACTERIAL SIALIDASE
    0.001  42%  1cwvA  [b.1.14 - b.1.14 - b.1.14 - b.1.14 - d.169.1] INVASIN(query 3503->3568)
:3824

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxDGDHVFTATATNDRGTSGQSVSFTIDIDTQPPVLEGLAVSDVGDRLTGTTEAGSTVVI
1l0qA           ------------DGTKVYVANASNDVSTATNNVIATVPAGSSP---QGVAVSPDGKQVY-VTNASSTLSV
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           KDSQGNTLGSGTAGDDGTFSIGISPAKINGETLSISVTDKAANSGPVETLNAPDKTAPAAPDGLIVATDG
1l0qA           IDTTSNTVAGTVKTGKSPLGLALSP---DGKKLYVT------NNGTVSVINTVTKSVGRSPKGIAVTPDG
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LSVSGQAEAGATVTIRDSSNTVLGSAVANGNGQFIVPLNTAQTNGQALIATATDVAKNESAAATVIAPDS
1l0qA           TKVY-VANFDSSISVIDTTNSVIDTVEAAPSGIAVNPEGTKATNVDKYFNTVSDTGTNKITARIPVGPD-
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           TAPEMPKNVVISEDGTSIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           -----PAGIAVTPDGKKV----------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:1680
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1890
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTLDNGALTNDSRPTLNGTGEAGATIRILDNGVEI
1l0qA           ----------------------------------------------------------------------
1cwvA           ------------------------------------TTNNGALPNKITEKTDANGVARIALTNTTDGVTV
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1960
query           GSATVDQSGNWRFTPNAPLENIAHIFTAVATDPAGNSGQPSDGFTLNIDAQAPDVPVITSVIDDNNQPTV
1l0qA           ----------------------------------------------------------------------
1cwvA           VTAEVEQSVDTHFTIAADKSTLAAVPTSIIAD-----GLMASTITLELKDTYGDPQAGANVAFDTTLGNM
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:2030
query           PVLPGQSTDDRQPILNGTGEPGATITIFDNGTPLGTAQVGENGSWTFPVPRNLSEGSHNLTVSATDPAGN
1l0qA           ----------------------------------------------------------------------
1cwvA           GVITDHNDGTYSAPLTSTTLGVATVTVKVDGAAFSVPSVTVNSSFTVSTPDILADGTMSSTLSFVPVDKN
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:2100
query           TSAVSAPWTIVVDITPPAIPVLTSVVDDQPGITGNLVSGQLTNDATPTxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           GHFISGMQGL--SFTQNGVPVSISPITEQPDSYTATVVGNSVGDVTIT----------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:2170
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:2240
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:2310
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:2380
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:2450
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:2520
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:2590
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:2660
query           xxxxxxxxxxxxxxxEANSAVSIFDNGALVATVNANASGNWSWTPTAALGQGSHAYXXXXXXXXXXXXXX
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ---------------DANKTVELSDGRVLL---NSRDSARSGYRKVAVSTDGGHSYGPVTIDRDLPDPTN
2bq9A           ---------------DANKTVELSDGRVLL---NSRDSARSGYRKVAVSTDGGHSYGPVTIDRDLPDPTN
1cwvA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:2730
query           XPSITIIVDTIAPGAPGNLVINATGNRVTGTAEAGSTVTITSETGVVLGTATADGTGSFTATLTPAQTNG
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           NASI-IRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIRMSCDDGQTWPVSKVFQPGSMSYSTLTALPDG
2bq9A           NASI-IRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIRMSCDDGQTWPVSKVFQPGSMSYSTLTALPDG
1cwvA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:2800
query           QPLLAFAQDKAGNTGIAAGFTAPDTRVPEAPIITNVVDDVGIYTGAIANGQVTNDAQPTLNGTAQAGATV
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           TYGLLYEPNLAWLGGICAPFTIPDVQVTVPVAVTNAVPKPSLQLDASPDWQVQGSVEPLMPGTVPAGTTP
2bq9A           TYGLLYEPNLAWLGGICAPFTIPDVQVTVPVAVTNAVPKPSLQLDASPDWQVQGSVEPLMPGTVPAGTTP
1cwvA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:2870
query           SIYNNGALLGTTTANASGNWSFTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           GRYRVGATLRTSAGNASTTFTVT-----------------------------------------------
2bq9A           GRYRVGATLRTSAGNASTTFTVT-----------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:2940
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:3010
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:3080
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:3150
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:3220
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:3290
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:3360
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:3430
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:3500
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:3570
query           xxGASLVFDVSTLITLGNLNISWAIQENGTVIRNGTVPVANITLGSATVTVNLSGLELDAGTYTLNFTxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           --GANVAFDT----TLGNMGVI-TDHNDGTY----SAPLTSTTLGVATVTVKVDGAAFSVPSVTVNFT--


                         .         .         *         .         .         .         .:3640
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:3710
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:3780
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------
2bq9C           ----------------------------------------------------------------------
2bq9A           ----------------------------------------------------------------------
1cwvA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:3850
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l0qA           --------------------------------------------
1cwvA           --------------------------------------------
2bq9C           --------------------------------------------
2bq9A           --------------------------------------------
1cwvA           --------------------------------------------