[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:ACF70211.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3fppB.bssp"
#ERROR : Can't open dsspfile "3fppA.bssp"

## Summary of PDB Search
:396
    3e-05  27%  3fppB  [x.x.x] MACROLIDE-SPECIFIC EFFLUX PROTEIN MACA
    3e-05  27%  3fppA  [x.x.x] MACROLIDE-SPECIFIC EFFLUX PROTEIN MACA
:396

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3fppB           ----------------------------------------------------------------------
3fppA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3fppB           ----------------------------------------------------------------------
3fppA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxRAQLADTEAELRDALASVNKELAITQRLEKSGAASHVEVLRLQRQKSDLGLKITDLRS
3fppB           ------------RAQRQQAEAELKLARVTYSRQ----QRLAQTQAVSQQD---LDNAATEMAVK------
3fppA           ------------RAQRQQAEAELKLARVTYSRQ----QRLAQTQAVSQQD---LDNAATEMAVK------


                         .         .         .         +         .         .         .:280
query           QYYVQAREALSKANAEVDMLSAILKGREDSVTRLTVRSPVRGIVKNIQVTTIGGVIPPNGEMMEIVPVDD
3fppB           ------QAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVT--QITTLQGTVIAAQQAPNILTLAD
3fppA           ------QAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVT--QITTLQGTVIAAQQAPNILTLAD


                         .         *         .         .         .         .         +:350
query           RLLIETRLSPRDIAFIHPGQRALVKITAYDYAIYGGLDGVVETISPDTIQDKVKPEIFYYRVFxxxxxxx
3fppB           MMLVKAQVSEADVIHLKPGQKAWFTVLGDQLTRY---EGQIKDVLP--TPEKVNDAIFYYARF-------
3fppA           MMLVKAQVSEADVIHLKPGQKAWFTVLGDQLTRY---EGQIKDVLP--TPEKVNDAIFYYARF-------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3fppB           ----------------------------------------------
3fppA           ----------------------------------------------