[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:cpsB

[Show Plain Result]

#ERROR : Can't open dsspfile "2cu2A.bssp"
#ERROR : Can't open dsspfile "2qh5B.bssp"
#ERROR : Can't open dsspfile "2qh5A.bssp"
#ERROR : Can't open dsspfile "1j58A.bssp"

## Summary of PDB Search
:478
    4e-37  36%  2cu2A  [x.x.x] PUTATIVE MANNOSE-1-PHOSPHATE GUANYLYL
    1e-36  35%  2qh5B  [x.x.x] MANNOSE-6-PHOSPHATE ISOMERASE
    2e-35  34%  2qh5A  [x.x.x] MANNOSE-6-PHOSPHATE ISOMERASE
    8e-04  36%  1j58A  [b.82.1] YVRK PROTEIN
:478

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxKLYPVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPVVICNEQHRFIVAE
2cu2A           ----KTYALVMAGGRGERLWPLSREDRPKPFLPLFEGKTLLEATLERLAPLVPPERTLLAVRRDQEAVAR
2qh5B           ----------------------SRSLYPKQFLKLFDHKSLFELSFKR-NASLVDETLIVCNEKHYFLALE
2qh5A           --------------------------YPKQFLKLFDHKSLFELSFKR-NASLVDETLIVCNEKHYFLALE
1j58A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QLRQLNKLTENIILEPAGRNTXXXXXXXXXXXTRQHTDCDPLMLVLAADHAIANEEAFRDAVRGAMPYAD
2cu2A           PYADGIRL----LLEPLGRDTXXXXXXXXXXXXKEGAE---RLLVLPADHYVGDDEAYRXXXXXXXXXXX
2qh5B           EIKEIKNKSVGFLLESLSKNTANAIALSALM-----SDKEDLLIVTPSDHLIKDLQAYENAIKKAIDLAQ
2qh5A           EIKEIKNKSVGFLLESLSKNTANAIALSALM-----SDKEDLLIVTPSDHLIKDLQAYENAIKKAIDLAQ
1j58A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AGKLVTFGIVPDLPETGYGYIRRGDVVPGATDAVAFEVAQFVEKPGLETAQAYVASGDYYWNSGMFLFRA
2cu2A           XGFVVALGLRPTRPETEYGYIRL-----GPREGAWYRGEGFVEKPSYAEALEYIRKG-YVWNGGVFAFAP
2qh5B           KGFLVTFGVSIDKPNTEFGYIESPN---------GLDVKRFIEKPSLDKAIEFQKSGGFYFNSGMFVFQA
2qh5A           KGFLVTFGVSIDKPNTEFGYIESPN---------GLDVKRFIEKPSLDKAIEFQKSGGFYFNSGMFVFQA
1j58A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GRYLEELKKFRPDILAACEQAMRGVDPDLDFIRVDEEAFLACPEESIDYAVMERTADAVVMPMDAGWSDV
2cu2A           ATMAELFRRHLPSHHEALERLLAGASL--------EEVYAGLPKISIDYGVMEKAERVRVVLGRFPWDDV
2qh5B           GVFLDELKKHAPTILKGCERAFESLENAYFFARLSEKSMQDLEDMSIDIALMQQSHKIKMVELNAKWSD-
2qh5A           GVFLDELKKHAPTILKGCERAFESLENAYFFARLSEKSMQDLEDMSIDIALMQQSHKIKMVELNAKWSD-
1j58A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GSWSSLWEISAHTPEGNVHHGDVISHKTENSYVYAESXXXXXXXXXXXXXXQTKDAVLIADRHAVQDVKK
2cu2A           GNWRALERVFSQDPHENVGEGRHVALDTFGCVVYADRGVVATLGVSGLVVAKVGDEVLVVPKDWAREVRE
2qh5B           ----------------------------------------------------------------------
2qh5A           ----------------------------------------------------------------------
1j58A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VVEKIKAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQMHHHRAEHWVVVAGTARVT
2cu2A           VVKRLEA---------------------------------------------------------------
2qh5B           ----------------------------------------------------------------------
2qh5A           ----------------------------------------------------------------------
1j58A           --------------------------------------------------ELHWHKEAEWAYIYGSARVT


                         .         .         +         .         .         .         .:490
query           INGEVKLLGENESIYIPLGATHCLExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cu2A           ----------------------------------------------------------
2qh5B           ----------------------------------------------------------
2qh5A           ----------------------------------------------------------
1j58A           IVDEIDDVGEGDLWYFPSGLPHSIQ---------------------------------