[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for sent8:rplY

[Show Plain Result]

#ERROR : Can't open dsspfile "1dfuP.bssp"

## Summary of PDB Search
:94
    9e-47  91%  1dfuP  [b.53.1] RIBOSOMAL PROTEIN L25
:94

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
1dfuP           MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGKEAPLAIELDHDKVMNMQAKAEFYSEVLTIVVDGKEI


                         .         .         *         .         .         .         .:140
query           KVKAQAVQRHAYKPKLTHIDFVRA
1dfuP           KVKAQDVQRHPYKPKLQHIDFVRA