[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF65854.1

[Show Plain Result]


## Summary of Sequence Search
    1::364
    1::364       0.0  96%  364 aa  YEJB_ECOLI RecName: Full=Inner membrane ABC transporter permease
    1::364       0.0  96%  364 aa  YEJB_ECO57 RecName: Full=Inner membrane ABC transporter permease
    1::316     3e-36  34%  316 aa  APPB_BACSU RecName: Full=Oligopeptide transport system permease
    4::306     1e-33  30%  306 aa  OPPB_SALTY RecName: Full=Oligopeptide transport system permease
    4::306     3e-31  29%  306 aa  OPPB_SHIFL RecName: Full=Oligopeptide transport system permease
    4::306     3e-31  29%  306 aa  OPPB_ECOLI RecName: Full=Oligopeptide transport system permease
    4::306     3e-31  29%  306 aa  OPPB_ECOL6 RecName: Full=Oligopeptide transport system permease
    4::306     3e-31  29%  306 aa  OPPB_ECO57 RecName: Full=Oligopeptide transport system permease
    1::313     2e-30  29%  313 aa  Y4TP_RHISN RecName: Full=Probable peptide ABC transporter permease
    1::314     4e-30  31%  314 aa  Y1092_BRUSU RecName: Full=Putative peptide transport system
   30::302     4e-30  31%  308 aa  DPPB_BACSU RecName: Full=Dipeptide transport system permease
    2::315     6e-30  31%  315 aa  Y209_BRUME RecName: Full=Putative peptide transport system permease
    1::314     6e-30  31%  314 aa  Y1050_BRUA2 RecName: Full=Putative peptide transport system
    1::314     6e-30  31%  314 aa  Y1031_BRUAB RecName: Full=Putative peptide transport system
    4::335     1e-29  31%  339 aa  DPPB_ECOLI RecName: Full=Dipeptide transport system permease
    4::335     1e-29  31%  339 aa  DPPB_ECOL6 RecName: Full=Dipeptide transport system permease
    4::335     1e-29  31%  339 aa  DPPB_ECO57 RecName: Full=Dipeptide transport system permease
   33::306     4e-29  30%  306 aa  OPPB_HAEIN RecName: Full=Oligopeptide transport system permease
    1::331     1e-27  31%  333 aa  DPPB_HAEIN RecName: Full=Dipeptide transport system permease
    4::302     1e-24  30%  311 aa  OPPB_BACSU RecName: Full=Oligopeptide transport system permease
   40::333     7e-24  26%  333 aa  DPPB_BACPF RecName: Full=Dipeptide transport system permease
   40::306     2e-23  29%  306 aa  GSIC_SALPA RecName: Full=Glutathione transport system permease
   40::306     3e-23  29%  306 aa  GSIC_SALTY RecName: Full=Glutathione transport system permease
   40::306     4e-23  29%  306 aa  GSIC_SALTI RecName: Full=Glutathione transport system permease
   40::306     4e-23  29%  306 aa  GSIC_SALCH RecName: Full=Glutathione transport system permease
    4::306     6e-23  30%  314 aa  NIKB_ECOLI RecName: Full=Nickel transport system permease protein
    1::316     1e-22  30%  319 aa  OPPB_LACLS RecName: Full=Oligopeptide transport system permease
    1::316     1e-22  30%  319 aa  OPPB_LACLA RecName: Full=Oligopeptide transport system permease
  196::316     3e-20  42%  319 aa  Y3860_BRUME RecName: Full=Putative peptide permease protein
  196::316     3e-20  42%  319 aa  Y3408_BRUSU RecName: Full=Putative peptide permease protein
  196::316     3e-20  42%  319 aa  Y2551_BRUO2 RecName: Full=Putative peptide permease protein
   47::306     2e-19  28%  306 aa  GSIC_ERWCT RecName: Full=Glutathione transport system permease
   40::306     5e-17  27%  306 aa  GSIC_SHISS RecName: Full=Glutathione transport system permease
   40::306     5e-17  27%  306 aa  GSIC_SHIDS RecName: Full=Glutathione transport system permease
   40::306     5e-17  27%  306 aa  GSIC_ECOUT RecName: Full=Glutathione transport system permease
   40::306     5e-17  27%  306 aa  GSIC_ECOLI RecName: Full=Glutathione transport system permease
   40::306     5e-17  27%  306 aa  GSIC_ECOL5 RecName: Full=Glutathione transport system permease
   40::306     5e-17  27%  306 aa  GSIC_ECOK1 RecName: Full=Glutathione transport system permease
   40::306     8e-17  27%  306 aa  GSIC_ECO57 RecName: Full=Glutathione transport system permease
   40::306     1e-16  26%  306 aa  GSIC_SHIFL RecName: Full=Glutathione transport system permease
   40::306     1e-16  26%  306 aa  GSIC_SHIF8 RecName: Full=Glutathione transport system permease
   40::306     2e-16  26%  306 aa  GSIC_ECOL6 RecName: Full=Glutathione transport system permease
   40::306     4e-16  26%  306 aa  GSIC_SHIBS RecName: Full=Glutathione transport system permease
   52::311     2e-14  29%  321 aa  SAPB_SALTY RecName: Full=Peptide transport system permease protein
   52::311     2e-14  29%  321 aa  SAPB_SALTI RecName: Full=Peptide transport system permease protein
    7::303     2e-13  26%  328 aa  OPPB2_STAAW RecName: Full=Putative oligopeptide transport system
    7::303     2e-13  26%  328 aa  OPPB2_STAAS RecName: Full=Putative oligopeptide transport system
    7::303     2e-13  26%  328 aa  OPPB2_STAAN RecName: Full=Putative oligopeptide transport system
    7::303     2e-13  26%  328 aa  OPPB2_STAAM RecName: Full=Putative oligopeptide transport system
    7::303     2e-13  26%  328 aa  OPPB2_STAAC RecName: Full=Putative oligopeptide transport system
    7::303     2e-13  26%  328 aa  OPPB2_STAA8 RecName: Full=Putative oligopeptide transport system
    7::303     2e-13  26%  328 aa  OPPB2_STAA3 RecName: Full=Putative oligopeptide transport system
   52::311     2e-13  28%  321 aa  SAPB_ECOLI RecName: Full=Peptide transport system permease protein
   52::311     2e-13  28%  321 aa  SAPB_ECO57 RecName: Full=Peptide transport system permease protein
  283::490     4e-13  25%  498 aa  AMIC_STRR6 RecName: Full=Oligopeptide transport system permease
  283::490     4e-13  25%  498 aa  AMIC_STRPN RecName: Full=Oligopeptide transport system permease
    7::303     2e-12  26%  328 aa  OPPB2_STAAR RecName: Full=Putative oligopeptide transport system
    7::303     5e-12  26%  328 aa  OPPB2_STAAB RecName: Full=Putative oligopeptide transport system
  182::322     5e-11  25%  325 aa  Y1314_MYCBO RecName: Full=Putative peptide transport permease
  182::322     5e-11  25%  325 aa  Y1283_MYCTU RecName: Full=Putative peptide transport permease
  167::295     3e-09  25%  389 aa  OPPB_MYCPN RecName: Full=Oligopeptide transport system permease
  185::313     2e-08  29%  407 aa  OPPB_MYCGE RecName: Full=Oligopeptide transport system permease
   45::282     3e-08  25%  321 aa  SAPB_HAEIN RecName: Full=Peptide transport system permease protein
  132::275     8e-06  28%  341 aa  YEJE_ECOLI RecName: Full=Inner membrane ABC transporter permease
  154::296     8e-06  27%  296 aa  Y207_BRUME RecName: Full=Putative peptide transport system permease
  154::296     8e-06  27%  296 aa  Y1051_BRUA2 RecName: Full=Putative peptide transport system
  154::296     8e-06  27%  296 aa  Y1032_BRUAB RecName: Full=Putative peptide transport system
  154::296     1e-05  27%  296 aa  Y1093_BRUSU RecName: Full=Putative peptide transport system
   31::77      9e-05  43%   89 aa  RS14_PROA2 RecName: Full=30S ribosomal protein S14;
  170::249     2e-04  26%  305 aa  OPPC_BACSU RecName: Full=Oligopeptide transport system permease
  168::235     4e-04  34%  294 aa  OPPC_LACLS RecName: Full=Oligopeptide transport system permease
   31::77      5e-04  40%   89 aa  RS14_PROVI RecName: Full=30S ribosomal protein S14;
  168::235     5e-04  34%  294 aa  OPPC_LACLA RecName: Full=Oligopeptide transport system permease
   31::77      6e-04  40%   89 aa  RS14_PELLD RecName: Full=30S ribosomal protein S14;
  201::334     6e-04  20%  340 aa  DDPB_ECOLI RecName: Full=Probable D,D-dipeptide transport system
    1::364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGAYLIRRLLLVIPTLWAIITINFFIVQIAPGGPVDQAIAAIEFGQGGALPGASGEGVRASHAQTGVGNI
YEJB_ECOLI      MGAYLIRRLLLVIPTLWAIITINFFIVQIAPGGPVDQAIAAIEFGNAGVLPGAGGEGVRASHAQTGVGNI
YEJB_ECO57      MGAYLIRRLLLVIPTLWAIITINFFIVQIAPGGPVDQAIAAIEFGNAGVLPGAGGEGVRASHAQTGVGNI
APPB_BACSU      MAAYIIRRTLMSIPILLGITILSFVIMKAAPGDPMTLM--------------------------------
OPPB_SALTY      ---FILRRCLEAIPTLFILITISFFMMRLAPGSP------------------------------------
OPPB_SHIFL      ---FILRRCLEAIPTLFILITISFFMMRLAPGSP------------------------------------
OPPB_ECOLI      ---FILRRCLEAIPTLFILITISFFMMRLAPGSP------------------------------------
OPPB_ECOL6      ---FILRRCLEAIPTLFILITISFFMMRLAPGSP------------------------------------
OPPB_ECO57      ---FILRRCLEAIPTLFILITISFFMMRLAPGSP------------------------------------
Y4TP_RHISN      MGVYILRRLVSTIAVMAMVGIFIFLLLRLAPGDP-----AAVIAG-----PTAT----------------
Y1092_BRUSU     MTALILKRVAQAIPVMLIVAILTFLLMKLLPGDP---AILI-----------------------------
DPPB_BACSU      ---------------------------------------------------------------------I
Y209_BRUME      MTALILKRVAQAIPVMLIVAILTFLLMKLLPGDP---AILI-----------------------------
Y1050_BRUA2     MTALILKRVAQAIPVMLIVAILTFLLMKLLPGDP---AILI-----------------------------
Y1031_BRUAB     MTALILKRVAQAIPVMLIVAILTFLLMKLLPGDP---AILI-----------------------------
DPPB_ECOLI      ---FILRRLGLVIPTFIGITLLTFAFVHMIPGDPV--MIMA-----------------------------
DPPB_ECOL6      ---FILRRLGLVIPTFIGITLLTFAFVHMIPGDPV--MIMA-----------------------------
DPPB_ECO57      ---FILRRLGLVIPTFIGITLLTFAFVHMIPGDPV--MIMA-----------------------------
OPPB_HAEIN      ----------------------------------------------------------------------
DPPB_HAEIN      MFKFVFKRILMVIPTFIAITLITFALVHFIPGDPVEIMM-------------------------------
OPPB_BACSU      ---YIGRRLVYMIITLFVIVTVTFFLMQAAPGGP------------------------------------
DPPB_BACPF      ----------------------------------------------------------------------
GSIC_SALPA      ----------------------------------------------------------------------
GSIC_SALTY      ----------------------------------------------------------------------
GSIC_SALTI      ----------------------------------------------------------------------
GSIC_SALCH      ----------------------------------------------------------------------
NIKB_ECOLI      ---YVLRRFLLLIPMVLAASVIIFLMLRLGTGDP------ALDYLRLSNLPPT-----------------
OPPB_LACLS      MWKVIIRRILLMIPQLFILSILVFFFAKLMPGDPFSGLI-------------------------------
OPPB_LACLA      MWKVIIRRILLMIPQLFILSILVFFFAKLMPGDPFSGLI-------------------------------
Y3860_BRUME     ----------------------------------------------------------------------
Y3408_BRUSU     ----------------------------------------------------------------------
Y2551_BRUO2     ----------------------------------------------------------------------
GSIC_ERWCT      ----------------------------------------------------------------------
GSIC_SHISS      ----------------------------------------------------------------------
GSIC_SHIDS      ----------------------------------------------------------------------
GSIC_ECOUT      ----------------------------------------------------------------------
GSIC_ECOLI      ----------------------------------------------------------------------
GSIC_ECOL5      ----------------------------------------------------------------------
GSIC_ECOK1      ----------------------------------------------------------------------
GSIC_ECO57      ----------------------------------------------------------------------
GSIC_SHIFL      ----------------------------------------------------------------------
GSIC_SHIF8      ----------------------------------------------------------------------
GSIC_ECOL6      ----------------------------------------------------------------------
GSIC_SHIBS      ----------------------------------------------------------------------
SAPB_SALTY      ----------------------------------------------------------------------
SAPB_SALTI      ----------------------------------------------------------------------
OPPB2_STAAW     ----MLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKIL------------------------HLDVAQV
OPPB2_STAAS     ----MLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKIL------------------------HLDVAQV
OPPB2_STAAN     ----MLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKIL------------------------HLDVAQV
OPPB2_STAAM     ----MLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKIL------------------------HLDVAQV
OPPB2_STAAC     ----MLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKIL------------------------HLDVAQV
OPPB2_STAA8     ----MLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKIL------------------------HLDVAQV
OPPB2_STAA3     ----MLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKIL------------------------HLDVAQV
SAPB_ECOLI      ----------------------------------------------------------------------
SAPB_ECO57      ----------------------------------------------------------------------
AMIC_STRR6      ----------------------------------------------------------------------
AMIC_STRPN      ----------------------------------------------------------------------
OPPB2_STAAR     ----ILYRLIQMIVVLFVISTLAFILMKLSPGNPVDKIL------------------------HLDVAQV
OPPB2_STAAB     ----MLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKIL------------------------HLDVAQV
Y1314_MYCBO     ----------------------------------------------------------------------
Y1283_MYCTU     ----------------------------------------------------------------------
OPPB_MYCPN      ----------------------------------------------------------------------
OPPB_MYCGE      ----------------------------------------------------------------------
SAPB_HAEIN      ----------------------------------------------------------------------
YEJE_ECOLI      ----------------------------------------------------------------------
Y207_BRUME      ----------------------------------------------------------------------
Y1051_BRUA2     ----------------------------------------------------------------------
Y1032_BRUAB     ----------------------------------------------------------------------
Y1093_BRUSU     ----------------------------------------------------------------------
RS14_PROA2      ----------------------------------------------------------------------
OPPC_BACSU      ----------------------------------------------------------------------
OPPC_LACLS      ----------------------------------------------------------------------
RS14_PROVI      ----------------------------------------------------------------------
OPPC_LACLA      ----------------------------------------------------------------------
RS14_PELLD      ----------------------------------------------------------------------
DDPB_ECOLI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SDSHYRGGRGLDPEVIAEITHRYGFDKPLHERYFKMLRDYLSFDFNDSLFRSASVLTLIKDSLPVSITLG
YEJB_ECOLI      SDSNYRGGRGLDPEVIAEITHRYGFDKPIHERYFKMLWDYIRFDFGDSLFRSASVLTLIKDSLPVSITLG
YEJB_ECO57      SDSNYRGGRGLDPEVIAEITHRYGFDKPIHERYFKMLWDYIRFDFGDSLFRSASVLTLIKDSLPVSITLG
APPB_BACSU      ----------MDPKISQQFIEKYGLNDPQYVQYLKWLGNMVQGDFGTSIVRKGTVSELIMARLPNTLLLM
OPPB_SALTY      ----FTGERALPPEVLANIEAKYHLNDPIMTQYFSYLKQLAHGDFGPSFYKDYTVNDLVAASFPVSAKLG
OPPB_SHIFL      ----FTGERTLPPEVMANIEAKYHLNDPIMTQYFSYLKQLAHGDFGPSFYKDYSVNDLVASSFPVSAKLG
OPPB_ECOLI      ----FTGERTLPPEVMANIEAKYHLNDPIMTQYFSYLKQLAHGDFGPSFYKDYSVNDLVASSFPVSAKLG
OPPB_ECOL6      ----FTGERTLPPEVMANIEAKYHLNDPIMTQYFSYLKQLAHGDFGPSFYKDYSVNDLVASSFPVSAKLG
OPPB_ECO57      ----FTGERTLPPEVMANIEAKYHLNDPIMTQYFSYLKQLAHGDFGPSFYKDYSVNDLVASSFPVSAKLG
Y4TP_RHISN      ------------EQMVANIREELGLNEPLPVQFVHWASDVLRGNFGASVFTGVPVLQLLSQRLEPTISLS
Y1092_BRUSU     ------AGDGASPETVERIRVELGLDQPTVVQLGQWLWNLFHFDLGRSFLLSQPVSQAIAERLPVTISLA
DPPB_BACSU      PGSPFNEERGTNEAVQKNLEAYYHLDDPLIFQYIFYLKSIITFDFGPSIKKSDSVNDMLERGFPVSFELG
Y209_BRUME      ------AGDGASPETVERIRVELGLDQPTVVQLGQWLWNLFHFDLGRSFLLSQPVSQAIAERLPVTISLA
Y1050_BRUA2     ------AGDGASPETVERIRVELGLDQPTVVQLGQWLWNLFHFDLGRSFLLSQPVSQAIAERLPVTISLA
Y1031_BRUAB     ------AGDGASPETVERIRVELGLDQPTVVQLGQWLWNLFHFDLGRSFLLSQPVSQAIAERLPVTISLA
DPPB_ECOLI      ------GERGISPERHAQLLAELGLDKPMWQQYLHYIWGVMHGDLGISMKSRIPVWEEFVPRFQATLELG
DPPB_ECOL6      ------GERGISPERHAQLLAELGLDKPMWQQYLHYIWGVMHGDLGISMKSRIPVWEEFVPRFQATLELG
DPPB_ECO57      ------GERGISPERHAQLLAELGLDKPMWQQYLHYIWGVMHGDLGISMKSRIPVWEEFVPRFQATLELG
OPPB_HAEIN      --SPFTSERAYPPEVMANIEAKYHLNEPLYKQYFLYLENLSKGDFGPSFYKDQSVNDLIASAFPVSIKLG
DPPB_HAEIN      ------GERGLTAEVHQQMMHQLGLDLPLYQQYFHYIGNVIQGDFGASFRTQQPVLTEFFTLFPATAELA
OPPB_BACSU      ----FSGEKKLPPEIEANLNAHYGLDKPLFVQYVSYLKSVAMWDFGPSFYKGQSVNDLISSGFPVSFTXX
DPPB_BACPF      -------GEQASPQAIADLEERLGLNEPYWVQYGLYMKDLATGDLGTSLRTNKPIMEEIWPYLAATIELT
GSIC_SALPA      -------GPEADAQVIALVRQQLGLDQPLHVQFWRYITHVLQGDFGTSMVSRRPVSEEIASRFLPTLWLT
GSIC_SALTY      -------GPEADAQVIALVRQQLGLDQPLHVQFWHYITHVLQGDFGTSMVSRRPVSEEIASRFLPTLWLT
GSIC_SALTI      -------GPEADAQVIALVRQQLGLDQPLHVQFWHYITHVLQGDFGTSMVSRRPVSEEIASRFLPTLWLT
GSIC_SALCH      -------GPEADAQVIALVRQQLGLDQPLHVQFWHYITHVLQGDFGTSMVSRRPVSEEIASRFLPTLWLT
NIKB_ECOLI      ------------PEMLASTRTMLGLDQPLYVQYGTWLWKALHLDFGISFASQRPVLDDMLNFLPATLELA
OPPB_LACLS      -------GPHTDPHEVEALRRAAGLYDPWWEQYLRWLGNAIHGNLGMSYNLKEPVMTVIGHRAINTFWMS
OPPB_LACLA      -------GPHTDPHEVEALRRAAGLYDPWWEQYLRWLGNAIHGNLGMSYNLKEPVMTVIGHRAINTFWMS
Y3860_BRUME     ----------------------------------------------------------------------
Y3408_BRUSU     ----------------------------------------------------------------------
Y2551_BRUO2     ----------------------------------------------------------------------
GSIC_ERWCT      --------------VIEMVRQDLGLDKPLPHQFWHFLTNILQGDLGTSMVSKRPVTQEIALRFMPTFWLT
GSIC_SHISS      -------GLEADAQVIELVRQQLGLDQPLYHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLT
GSIC_SHIDS      -------GPEADAQVIELVRQQLGLDQPLYHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLT
GSIC_ECOUT      -------GPEADAQVIELVRQQLGLDQPLYHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLT
GSIC_ECOLI      -------GPEADAQVIELVRQQLGLDQPLYHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLT
GSIC_ECOL5      -------GPEADAQVIELVRQQLGLDQPLYHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLT
GSIC_ECOK1      -------GPEADAQVIELVRQQLGLDQPLYHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLT
GSIC_ECO57      -------GPEADAQVIELVRQQLGLDQPLYHQFWHYISNAVQGDFGLSMVSRRPVADEIARRFMPTLWLT
GSIC_SHIFL      -------GPEADAQVIELVRQQLGLDQPLYHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLT
GSIC_SHIF8      -------GPEADAQVIELVRQQLGLDQPLYHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLT
GSIC_ECOL6      -------GPEADAQVIELVRQQLGLDQPLYHQFWHYISNAVQGDLGLSMVSRRPVADEIASRFMPTLWLT
GSIC_SHIBS      -------GPEADAQVIELVRQQLGLDQPLYHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLT
SAPB_SALTY      ----------------------------------------LHWDFGVSSINGQLISEQLKEVFPATMELC
SAPB_SALTI      ----------------------------------------LHWDFGVSSINGQLISEQLKEVFPATMELC
OPPB2_STAAW     ST-----------EQINATKDKLGLNDSLLVQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLIS
OPPB2_STAAS     ST-----------EQINATKDKLGLNDSLLVQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLIS
OPPB2_STAAN     ST-----------EQINATKDKLGLNDSLLVQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLIS
OPPB2_STAAM     ST-----------EQINATKDKLGLNDSLLVQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLIS
OPPB2_STAAC     ST-----------EQINATKDKLGLNDSLLVQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLIS
OPPB2_STAA8     ST-----------EQINATKDKLGLNDSLLVQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLIS
OPPB2_STAA3     ST-----------EQINATKDKLGLNDSLLVQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLIS
SAPB_ECOLI      ----------------------------------------IHWDFGVSSINGQPIAEQLKEVFPATMELC
SAPB_ECO57      ----------------------------------------IHWDFGVSSINGQPIAEQLKEVFPATMELC
AMIC_STRR6      -----------------------------------------------------------------SAITG
AMIC_STRPN      -----------------------------------------------------------------SAITG
OPPB2_STAAR     ST-----------EQINATKDKLGLNDSLLVQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLIS
OPPB2_STAAB     S-----------MEQINATKDKLGLNDSLLVQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLIS
Y1314_MYCBO     ----------------------------------------------------------------------
Y1283_MYCTU     ----------------------------------------------------------------------
OPPB_MYCPN      ----------------------------------------------------------------------
OPPB_MYCGE      ----------------------------------------------------------------------
SAPB_HAEIN      --------------------------------YFHYLGTLLQGDFGITYNGGKSLMNLILTVLPPTLELC
YEJE_ECOLI      ------------------------------------------------------VLARILYGTRISVLFG
Y207_BRUME      ----------------------------------------------------------------------
Y1051_BRUA2     ----------------------------------------------------------------------
Y1032_BRUAB     ----------------------------------------------------------------------
Y1093_BRUSU     ----------------------------------------------------------------------
RS14_PROA2      ----------------------------------------------------------------------
OPPC_BACSU      ----------------------------------------------------------------------
OPPC_LACLS      ----------------------------------------------------------------------
RS14_PROVI      ----------------------------------------------------------------------
OPPC_LACLA      ----------------------------------------------------------------------
RS14_PELLD      ----------------------------------------------------------------------
DDPB_ECOLI      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LWSTLIIYLVSIPLGIRKAVHNGSRFDVWSSAFIIIGYXXXXXXXXXXXXXXXXGGSYYDIFPLRGLVSA
YEJB_ECOLI      LWSTLIIYLVSIPLGIRKAVYNGSRFDVWSSAFIIIGYXXXXXXXXXXXXXXXXGGSYFDLFPLRGLVSA
YEJB_ECO57      LWSTLIIYLVSIPLGIRKAVYNGSRFDVWSSAFIIIGYXXXXXXXXXXXXXXXXGGSYFDLFPLRGLVSA
APPB_BACSU      LVSTILALMISIPFGVLSAKRPYSKIDYGITFTSFIGLAIPNFWFGLILIMVLSVNLGW--FPTGGVETL
OPPB_SALTY      AAAFLLAVIIGVSAGVIAALKQNTRWDYTVMGFAMTGVVIPS----------------FVVAPLLVMVFA
OPPB_SHIFL      AAAFFLAVILGVSAGVIAALKQNTKWDYTVMGLAMTGVVIPS----------------FVVAPLLVMIFA
OPPB_ECOLI      AAAFFLAVILGVSAGVIAALKQNTKWDYTVMGLAMTGVVIPS----------------FVVAPLLVMIFA
OPPB_ECOL6      AAAFFLAVILGVSAGVIAALKQNTKWDYTVMGLAMTGVVIPS----------------FVVAPLLVMIFA
OPPB_ECO57      AAAFFLAVILGVSAGVIAALKQNTKWDYTVMGLAMTGVVIPS----------------FVVAPLLVMIFA
Y4TP_RHISN      VLTMILSVTVGVSFGVLAAWRSGGFVDRALATFSAIGYSVPVFVIGYILIYFFAIQTRW--LPVQGYTSI
Y1092_BRUSU     LLAFAITIPVGIIMGVVAAYLRDSWFDMGVMSLALLGVSVPSFWLAILAVILFSVTLGW--FPSAGYV--
DPPB_BACSU      MTAIVIAVISGLVLGVIAALRRNGFLDYAAMSLAVLGISIPNFILATLLIQQFAVN--LKLFP-------
Y209_BRUME      LLAFAITIPVGIIMGVVAAYLRDSWFDTGVMSLALLGVSVPSFWLAILAVILFSVTLGW--FPSAGYV--
Y1050_BRUA2     LLAFAITIPVGIIMGVVAAYLRDSWFDTGVMSLALLGVSVPSFWLAILAVILFSVTLGW--FPSAGYV--
Y1031_BRUAB     LLAFAITIPVGIIMGVVAAYLRDSWFDTGVMSLALLGVSVPSFWLAILAVILFSVTLGW--FPSAGYV--
DPPB_ECOLI      VCAMIFATAVGIPVGVLAAVKRGSIFDHTAVGLALTGYSMPIFWWGMMLIMLV--SVHWNLTPVSGRVSM
DPPB_ECOL6      VCAMIFATAVGIPVGVLAAVKRGSIFDHTAVGLALTGYSMPIFWWGMMLIMLV--SVHWNLTPVSGRVSM
DPPB_ECO57      VCAMIFATAVGIPVGVLAAVKRGSIFDHTAVGLALTGYSMPIFWWGMMLIMLV--SVHWNLTPVSGRVSM
OPPB_HAEIN      MVAFAFAVVLGVTAGTLAALNQNSRWDYILMSFSMLGVIMPSFVFAPVLVLIF--AIYLGWLPAGG----
DPPB_HAEIN      FFALFWSLLGGIILGTIAAVKKDSWISHTVTAASLTGYSMPIFWWGLILILYV---SPQLGLPQGGRLDN
OPPB_BACSU      XXXXXXXXXXXXXXXXXXXXYHNKWQDYTVAILTIFGISVPSFIMAAVLQYVF--SMKLGLFPVAGWDS-
DPPB_BACPF      IFAMIFAIIIGVNAGIVSAWKQNSWFDYLSMFIALVGFWLALMEQWIFAQELGWLPAFGRDNPRDPIIST
GSIC_SALPA      ITSMIWAVLFGMAIGIAAAVWRNRWPDRLGMTLAVTGIS-------------------FPAFALGMLLMQ
GSIC_SALTY      ITSMIWAVLFGMAIGIAAAVWRNRWPDRLGMTLAVTGIS-------------------FPAFALGMLLMQ
GSIC_SALTI      ITSMIWAVLFGMAIGIAAAVWRNRWPDRVGMTLAVTGIS-------------------FPAFALGMLLMQ
GSIC_SALCH      ITSMIWAVLFGMAIGIAAAVWRNRWPDRVGMTLAVTGIS-------------------FPAFALGMLLMQ
NIKB_ECOLI      GAALVLILLTSVPLGIWAARHR-DRLPDFAVRFIAF-----------------LGVSMPNFWLAFLLVMA
OPPB_LACLS      LLSVILTYLFAIPMSIVAARNEGKWQDLWSITFGIPPYVFYLLIIFIF-------GYSLNWFPTGGTVSP
OPPB_LACLA      LLSVILTYLFAIPMSIVAARNEGKWQDLWSITFGIPPYVFYLLIIFIF-------GYSLNWFPTGGTVSP
Y3860_BRUME     ----------------------------------------------------------------------
Y3408_BRUSU     ----------------------------------------------------------------------
Y2551_BRUO2     ----------------------------------------------------------------------
GSIC_ERWCT      VCSMAWAVIFGMAIGIVSAVWRNGWPDRIGMTLAVSGLS-------------------FPAFALGMLLMQ
GSIC_SHISS      ITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS-------------------FPAFALGMLLIQ
GSIC_SHIDS      ITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS-------------------FPAFALGMLLIQ
GSIC_ECOUT      ITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS-------------------FPAFALGMLLIQ
GSIC_ECOLI      ITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS-------------------FPAFALGMLLIQ
GSIC_ECOL5      ITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS-------------------FPAFALGMLLIQ
GSIC_ECOK1      ITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS-------------------FPAFALGMLLIQ
GSIC_ECO57      ITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS-------------------FPAFALGMLLIQ
GSIC_SHIFL      ITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS-------------------FPAFALGMFLIQ
GSIC_SHIF8      ITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS-------------------FPAFALGMFLIQ
GSIC_ECOL6      ITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS-------------------FPAFALGMLLIQ
GSIC_SHIBS      ITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS-------------------FPAFALGMLLIQ
SAPB_SALTY      ILAFGFALMVGIPVGMLAGVTRSKWPDRFISALALLGFSIPVXXXXXXXXXXXXSGRFYEVKPVTGIIDA
SAPB_SALTI      ILAFGFALMVGIPVGMLAGVTRSKWPDRFISALALLGFSIPVXXXXXXXXXXXXSGRFYEVKPVTGIIDA
OPPB2_STAAW     -FSTLVVSLISIPLGIIAA----KRFHKWTDKVIRVISTLSISLPAFFIGIIL-------LFIVTNLM--
OPPB2_STAAS     -FSTLVVSLISIPLGIIAA----KRFHKWTDKVIRVISTLSISLPAFFIGIIL-------LFIVTNLM--
OPPB2_STAAN     -FSTLVVSLISIPLGIIAA----KRFHKWTDKVIRVISTLSISLPAFFIGIIL-------LFIVTNLM--
OPPB2_STAAM     -FSTLVVSLISIPLGIIAA----KRFHKWTDKVIRVISTLSISLPAFFIGIIL-------LFIVTNLM--
OPPB2_STAAC     -FSTLVVSLISIPLGIIAA----KRFHKWTDKVIRVISTLSISLPAFFIGIIL-------LFIVTNLM--
OPPB2_STAA8     -FSTLVVSLISIPLGIIAA----KRFHKWTDKVIRVISTLSISLPAFFIGIIL-------LFIVTNLM--
OPPB2_STAA3     -FSTLVVSLISIPLGIIAA----KRFHKWTDKVIRVISTLSISLPAFFIGIIL-------LFIVTNLM--
SAPB_ECOLI      ILAFGFALIVGIPVGMIAGITRHKWQDNLINAIALLGFSIPVXXXXXXXXXXXXSGRFYEVKPITGLIDA
SAPB_ECO57      ILAFGFALIVGIPVGMIAGITRHKWQDNLINAIALLGFSIPVXXXXXXXXXXXXSGRFYEVKPITGLIDA
AMIC_STRR6      LIGLVLAYALAVPLGSAMARFKNTWIDSLSTGALTFLLALPTIALVYIVRLIGSSIALPDSFPILGAGD-
AMIC_STRPN      LIGLVLAYALAVPLGSAMARFKNTWIDSLSTGALTFLLALPTIALVYIVRLIGSSIALPDSFPILGAGD-
OPPB2_STAAR     -FSTLVVSLISIPLGIIAA----KRFHKLSDKVIRVISTLSISLPAFFIGIIL-------LFIVTNLM--
OPPB2_STAAB     -FSTLVLSLISIPLGIIAA----KRFHKLSDKVIRVISTLSISLPAFFIGIIL-------LFIVTNLM--
Y1314_MYCBO     ----------------------------------------------------------------------
Y1283_MYCTU     ----------------------------------------------------------------------
OPPB_MYCPN      ----------------------------------------------------------------------
OPPB_MYCGE      ----------------------------------------------------------------------
SAPB_HAEIN      FITLFLAFIFGLPLGIISAVNSEQ---VFAKSLQILSYVGLSIPIFWLAPILLYVGQYYEIKSITGVIDM
YEJE_ECOLI      LMLTLCSSVMGVLAGALQGYYGG-KVDLWGQRFIEVWSGMP---------------TLFLIILLSSVVQP
Y207_BRUME      ----------------------------------------------------------------------
Y1051_BRUA2     ----------------------------------------------------------------------
Y1032_BRUAB     ----------------------------------------------------------------------
Y1093_BRUSU     ----------------------------------------------------------------------
RS14_PROA2      ----------------------------------------------------------------------
OPPC_BACSU      ----------------------------------------------------------------------
OPPC_LACLS      ----------------------------------------------------------------------
RS14_PROVI      ----------------------------------------------------------------------
OPPC_LACLA      ----------------------------------------------------------------------
RS14_PELLD      ----------------------------------------------------------------------
DDPB_ECOLI      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NFDTLPWYQKITDYLWHITLPVLATVIGGFAALTMLTKNSFLDEVRKQYVVTARAKGVSEKNILWKHVFR
YEJB_ECOLI      NFDSLPWYQKITDYLWHITLPVLATVIGGFAALTMLTKNSFLDEVRKQYVVTARAKGVSEKNILWKHVFR
YEJB_ECO57      NFDSLPWYQKITDYLWHITLPVLATVIGGFAALTMLTKNSFLDEVRKQYVVTARAKGVSEKNILWKHVFR
APPB_BACSU      NTEF-----NIFDRIHHLILPAFVLATADMAGLTRYTRSNMLDVLNQDYIRTARAKGFKENRVLFKHGLR
OPPB_SALTY      TLQWLPGGGWNGGALKFMILPMVALSLAYIASIARITRGSMIEVLHSNFIRTARAKGLPMRRIIFRHALK
OPPB_SHIFL      IIHWLPGGGWNGGALKFMILPMVALSLAYIASIARITRGSMIEVLHSNFIRTARAKGLPMRRIILRHALK
OPPB_ECOLI      IIHWLPGGGWNGGALKFMILPMVALSLAYIASIARITRGSMIEVLHSNFIRTARAKGLPMRRIILRHALK
OPPB_ECOL6      IIHWLPGGGWNGGALKFMILPMVALSLAYIASIARITRGSMIEVLHSNFIRTARAKGLPMRRIILRHALK
OPPB_ECO57      IIHWLPGGGWNGGALKFMILPMVALSLAYIASIARITRGSMIEVLHSNFIRTARAKGLPMRRIILRHALK
Y4TP_RHISN      NQGVAPWFL-------HLILPTVTLSVPYIAFIARITRGSMLEVLSEDYMRTAAAKGASPFAMLFHHALK
Y1092_BRUSU     -----PFLDSPLGWLRSLILPASILALFQIGYLARMTRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFR
DPPB_BACSU      ---AATWTSPI-----HMVLPTAALAVGPMAIIARLTRSSMVEVLTQDYIRTAKAKGLSPFKIIVKHALR
Y209_BRUME      -----PFLDSPLGWLRSLILPASILALFQIGYLARMTRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFR
Y1050_BRUA2     -----PFLDSPLGWLRSLILPASILALFQIGYLARMTRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFR
Y1031_BRUAB     -----PFLDSPLGWLRSLILPASILALFQIGYLARMTRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFR
DPPB_ECOLI      LIDTAIWGENFIDAVAHMILPAIVLGTIPLAVIVRMTRSSMLEVLGEDYIRTARAKGLTRMRVIIVHALR
DPPB_ECOL6      LIDTAIWGENFIDAVAHMILPAIVLGTIPLAVIVRMTRSSMLEVLGEDYIRTARAKGLTRMRVIIVHALR
DPPB_ECO57      LIDTAIWGENFIDAVAHMILPAIVLGTIPLAVIVRMTRSSMLEVLGEDYIRTARAKGLTRMRVIIVHALR
OPPB_HAEIN      ------WNGGTAMYM---ILPVASLTIAYVAGIARIMRGSMIEVLHSNFIRTAKAKGLSMSRIILKHALR
DPPB_HAEIN      EFDTPTGFMLIDSWLSGVSLPAIVLGTVPLAIITRMTRSAMLEVLGEDYIRTAKAKGLSYTRIVIVHALR
OPPB_BACSU      ---------------WAYTLPSIALASMPMAFIARLSRSSMIEVLNSDYIRTAKAKGLSRPAVTVRHAIR
DPPB_BACPF      TFDTIGQFDKTWESIKHLILPGIALGTIPMAIIARMTRSSMLEVLRSDYIRTVNAKGSGQGVVIYKHALK
GSIC_SALPA      IFSVLGWLPTVGADSWHYILPSLTLGAAVASVMARFTRSSFVDVLSEDYMRTARAKGVSETWVVLKHGLR
GSIC_SALTY      IFSVLGWLPTVGADSWHYILPSLTLGAAVASVMARFTRSSFVDVLSEDYMRTARAKGVSETWVVLKHGLR
GSIC_SALTI      IFSVLGWLPTVGADSWHYILPSLTLGAAVASVMARFTRSSFVDVLSEDYMRTARAKGVSETWVVLKHGLR
GSIC_SALCH      IFSVLGWLPTVGADSWHYILPSLTLGAAVASVMARFTRSSFVDVLSEDYMRTARAKGVSETWVVLKHGLR
NIKB_ECOLI      FSVYLQWLPAMGYGGWHIILPAVSIAFMSLAINARLLRASMLDVAGQRHVTWARLRGLNDKQTERRHILR
OPPB_LACLS      --DAMGIIPVFFSKIYHMILPAFSLAVFGTVGIFTYFRSGILDEQTQDYVRTARAKGVKEKVIFRRHILR
OPPB_LACLA      --DAMGIIPVFFSKIYHMILPAFSLAVFGTVGIFTYFRSGILDEQTQDYVRTARAKGVKEKVIFRRHILR
Y3860_BRUME     ----------------------------GHAALIMYMRSSMLETLNQDYVRTARAKGVREFWVVVKHTLR
Y3408_BRUSU     ----------------------------GHAALIMYMRSSMLETLNQDYVRTARAKGVREFWVVVKHTLR
Y2551_BRUO2     ----------------------------GHAALIMYMRSSMLETLNQDYVRTARAKGVREFWVVVKHTLR
GSIC_ERWCT      IFSVLGWLPTVGADTWHYILPSLTLGAAVAAVMARFTRASFVDVLQEDYMRTARAKGVRESLVVLKHGLR
GSIC_SHISS      VFSVLGWLPTVGADSWHYILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLR
GSIC_SHIDS      VFSVLGWLPTVGADSWHYILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLR
GSIC_ECOUT      VFSVLGWLPTVGADSWHYILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLR
GSIC_ECOLI      VFSVLGWLPTVGADSWHYILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLR
GSIC_ECOL5      VFSVLGWLPTVGADSWHYILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLR
GSIC_ECOK1      VFSVLGWLPTVGADSWHYILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLR
GSIC_ECO57      VFSVLGWLPTVGADSWHYILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLR
GSIC_SHIFL      VFSVLGWLPTVGADSWHYILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLR
GSIC_SHIF8      VFSVLGWLPTVGADSWHYILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLR
GSIC_ECOL6      VFSVLGWLPTVGADSWHYILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLR
GSIC_SHIBS      VFSVLGWLPTVGADSWHYILSSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLR
SAPB_SALTY      WISDSPWRDEVMSAIRHMVLPVLTLSVAPTTEVIRLMRISTIEVYDQNYVKAAATRGLSRFTILRRHVLH
SAPB_SALTI      WISDSPWRDEVMSAIRHMVLPVLTLSVAPTTEVIRLMRISTIEVYDQNYVKAAATRGLSRFTILRRHVLH
OPPB2_STAAW     NIDSVILSQFI--------LPVITLSLGMCAYIIRLVRSNLLMLLQSNIVQASRLRGMNERYILI-HDLL
OPPB2_STAAS     NIDSVILSQFI--------LPVITLSLGMCAYIIRLVRSNLLMLLQSNIVQASRLRGMNERYILI-HDLL
OPPB2_STAAN     NIDSVILSQFI--------LPVITLSLGMCAYIIRLVRSNLLMLLQSNIVQASRLRGMNERYILI-HDLL
OPPB2_STAAM     NIDSVILSQFI--------LPVITLSLGMCAYIIRLVRSNLLMLLQSNIVQASRLRGMNERYILI-HDLL
OPPB2_STAAC     NIDSVILSQFI--------LPVITLSLGMCAYIIRLVRSNLLMLLQSNIVQASRLRGMNERYILI-HDLL
OPPB2_STAA8     NIDSVILSQFI--------LPVITLSLGMCAYIIRLVRSNLLMLLQSNIVQASRLRGMNERYILI-HDLL
OPPB2_STAA3     NIDSVILSQFI--------LPVITLSLGMCAYIIRLVRSNLLMLLQSNIVQASRLRGMNERYILI-HDLL
SAPB_ECOLI      WLSDSPWRDEIMSAIRHMILPVITLSVAPTTEVIRLMRISTIEVYDQNYVKAAATRGLSRFTILRRHVLH
SAPB_ECO57      WLSDSPWRDEIMSAIRHMILPVITLSVAPTTEVIRLMRISTIEVYDQNYVKAAATRGLSRFTILRRHVLH
AMIC_STRR6      ------WRSYV--------LPAVILGLLGAPGTAIWIRRYMIDLQSQDFVRFARAKGLSEKEISNKHIFK
AMIC_STRPN      ------WRSYV--------LPAVILGLLGAPGTAIWIRRYMIDLQSQDFVRFARAKGLSEKEISNKHIFK
OPPB2_STAAR     NIDSVILSQFI--------LPVLTLSLGMCAYIIRLVRSNLLILLKSNIVQASRLRGMNERYILI-HDLL
OPPB2_STAAB     NIDSVILSQFI--------LPVITLSLGMCAYIIRLVRSNLLMLLQSNIVQASRLRGMNERYILI-HDLL
Y1314_MYCBO     -------WDRLGDRLQHXXXXXXXXXXXXXXGFSRYQRNAMLDVLGQDFIRTARAKGLTRRRALLKHGLR
Y1283_MYCTU     -------WDRLGDRLQHXXXXXXXXXXXXXXGFSRYQRNAMLDVLGQDFIRTARAKGLTRRRALLKHGLR
OPPB_MYCPN      -------------------IPILSLVFYTSAAFTYRVRNEVVEVMNQDYIKTARSKGLSTFAVALYHIFR
OPPB_MYCGE      -------------------IPILSLVFYSSAAFTYRIRNEVVEVMNQDYIKTAKSKGLGMFAVARYHIFR
SAPB_HAEIN      WFMEVPYRTKIVNILQHLALPTLVLCILPTMEIIRIIHQRAEYILNQNFSKVATTRGWSKWKILHQYVFR
YEJE_ECOLI      NF----W--------WLLAI----TVLFGWMSLVGVVRAEFLRTRNFDYIRAAQALGVSDRSIILRHMLP
Y207_BRUME      ----------------HLSSVIIALTSAYIPRCARIVRASALVLRETDYVDAARLAGASDLRIITRHILP
Y1051_BRUA2     ----------------HLSSVIIALTSAYIPRCARIVRASALVLRETDYVDAARLAGASDLRIITRHILP
Y1032_BRUAB     ----------------HLSSVIIALTSAYIPRCARIVRASALVLRETDYVDAARLAGASDLRIITRHILP
Y1093_BRUSU     ----------------HLSSVIIALTSAYIPRCARIVRASALVLRETDYVDAARLAGASDLRIITRHILP
RS14_PROA2      ---------------------------GDYEALSKLPRNSSATRVRNRCVLTGRGRGVYEKFGLCRHMFR
OPPC_BACSU      ---------------------IIAMTITGWINMARIVRGQVLQLKNQEYVLASQTLGAKTSRLLFKHIVP
OPPC_LACLS      ---------------------------------TRLIRARTMTEVNRDYVQASKTSGTSDFKIMFREIWP
RS14_PROVI      ---------------------------GDYEALRKLPRDSSASRVRNRCVLTGRGRGVYEKFGLCRHMFR
OPPC_LACLA      ---------------------------------TRLIRARTMTEVNRDYVRASKTSGTSDFKIMFREIWP
RS14_PELLD      ---------------------------GDYEALRKLPRDSSATRVRNRCVLTGRGRGVYEKFGLCRHMFR
DDPB_ECOLI      --------------LQHLILPALTLAFVHLGIVARQIRSAMLEQLSEDYIRTARASGLPGWYIVLCYALP


                         .         *         .         .         .         .         +:350
query           NAMLLVIAGFPATFISMFFTGSLLIEVMFSLNGLGLLGYEATVSRDYPVMFGTLYIFTLIGLLLNILSDI
YEJB_ECOLI      NAMLLVIAGFPATFISMFFTGSLLIEVMFSLNGLGLLGYEATVSRDYPVMFGTLYIFTLIGLLLNIVSDI
YEJB_ECO57      NAMLLVIAGFPATFISMFFTGSLLIEVMFSLNGLGLLGYEATVSRDYPVMFGTLYIFTLIGLLLNIVSDI
APPB_BACSU      NALLPVITIF-GLMIPSFIGGSVVVEQIFTWPGLGKLFVDSAFQRDYPVIMAMTVISAVLVVVGNLIADI
OPPB_SALTY      PALLPVLSYMGPAFVGII-TGSMVIETIYGLPGIGQLFVNGALNRDYSLVLSLTILVGALTILFNAIVDV
OPPB_SHIFL      PALLPVLSYMGPAFVGII-TGSMVIETIYGLPGIGQLFVNGALNRDYSLVLSLTILVGALTILFNAIVDV
OPPB_ECOLI      PALLPVLSYMGPAFVGII-TGSMVIETIYGLPGIGQLFVNGALNRDYSLVLSLTILVGALTILFNAIVDV
OPPB_ECOL6      PALLPVLSYMGPAFVGII-TGSMVIETIYGLPGIGQLFVNGALNRDYSLVLSLTILVGALTILFNAIVDV
OPPB_ECO57      PALLPVLSYMGPAFVGII-TGSMVIETIYGLPGIGQLFVNGALNRDYSLVLSLTILVGALTILFNAIVDV
Y4TP_RHISN      NAGVPILTVIGISFAYMI-GGVVLTETVFNVPGIGRLVVDAIKNRDYPIIQTVLVLISGLYVLINLLVDL
Y1092_BRUSU     NALVLTVSGY---IFSLLIGGSVVIEQIFALPGLGRLLVQAILARDLPVVQGTMLFLGFLFVAINVLVDI
DPPB_BACSU      NALMPVITVL-GTLVASILTGSFVIEKIFAIPGMGKYFVESINQRDYPVIMGTTVFYSVILIIMLFLVDL
Y209_BRUME      NALVLTVSGY---IFSLLIGGSVVIEQIFALPGLGRLLVQAILARDLPVVQGTMLFLGFLFVAINVLVDI
Y1050_BRUA2     NALVLTVSGY---IFSLLIGGSVVIEQIFALPGLGRLLVQAILARDLPVVQGTMLFLGFLFVAINVLVDI
Y1031_BRUAB     NALVLTVSGY---IFSLLIGGSVVIEQIFALPGLGRLLVQAILARDLPVVQGTMLFLGFLFVAINVLVDI
DPPB_ECOLI      NAMLPVVTVI-GLQVGTLLAGAILTETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVATMIILVNLLVDL
DPPB_ECOL6      NAMLPVVTVI-GLQVGTLLAGAILTETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVATMIILVNLLVDL
DPPB_ECO57      NAMLPVVTVI-GLQVGTLLAGAILTETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVATMIILVNLLVDL
OPPB_HAEIN      PALLPVITYLGPAFVGII-TGSMVIESVFGLPGMGLLFVNGALNRDYSLVLSLTILVGTLTILFNAIVDI
DPPB_HAEIN      NALIPVVT-VVGLIVAQLLSGAVLTETIFSWPGIGKWIIDAIQARDYPVLQGSVLIIATIIIVVNLTVDL
OPPB_BACSU      NALLPVVT-YMGPMAAQVLTGSFIIETIFGIPGLGAHFVNSITNRDYTVIMGVTXXXXXXXXXXXXXXXX
DPPB_BACPF      NALILTVVGLQT---GNLLGGAILTETIFSWPGIGRYIFEAINYRDYPVIQSGILVVATIFVLINLFVDL
GSIC_SALPA      NAMIPVVT-MMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVDMRDYPVIQAEVLLFSLEFILINLVVDV
GSIC_SALTY      NAMIPVVT-MMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVDMRDYPVIQAEVLLFSLEFILINLVVDV
GSIC_SALTI      NAMIPVVT-MMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVDMRDYPVIQAEVLLFSLEFILINLVVDV
GSIC_SALCH      NAMIPVVT-MMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVDMRDYPVIQAEVLLFSLEFILINLVVDV
NIKB_ECOLI      NASLPMITAV-GMHIGELIGGTMIIENIFAWPGVGRYAVSAIFNRDYPVIQCFTLMMVVVFVVCNLIVDL
OPPB_LACLS      NASLPIASNF-GFVITGLLGGAIFAETIFGYPGLGQLFITSISGRDYSMITAXXXXXXXXXXXXXXXSDI
OPPB_LACLA      NASLPIASNF-GFVITGLLGGAIFAETIFGYPGLGQLFITSISGRDYSMITAXXXXXXXXXXXXXXXSDI
Y3860_BRUME     NAMLPVVTLIGST-IGLAVGGAIFIESVFNWPGMGLLLINAVETRDYPVIMGATLVIGACVIIVNILTDL
Y3408_BRUSU     NAMLPVVTLIGST-IGLAVGGAIFIESVFNWPGMGLLLINAVETRDYPVIMGATLVIGACVIIVNILTDL
Y2551_BRUO2     NAMLPVVTLIGST-IGLAVGGAIFIESVFNWPGMGLLLINAVETRDYPVIMGATLVIGACVIIVNILTDL
GSIC_ERWCT      NALIPVVT-MMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEVLLFSLEFILINLLVDM
GSIC_SHISS      NAMIPVVT-MMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDV
GSIC_SHIDS      NAMIPVVT-MMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDV
GSIC_ECOUT      NAMIPVVT-MMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDV
GSIC_ECOLI      NAMIPVVT-MMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDV
GSIC_ECOL5      NAMIPVVT-MMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDV
GSIC_ECOK1      NAMIPVVT-MMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDV
GSIC_ECO57      NAMIPVVT-MMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDV
GSIC_SHIFL      NAMIPVVT-MMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDV
GSIC_SHIF8      NAMIPVVT-MMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDV
GSIC_ECOL6      NAMIPVVT-MMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDV
GSIC_SHIBS      NAMIPVVT-MMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAXXXXXXXXXXXXXXVVDV
SAPB_SALTY      NALPPVIPRLGLQFSTM-LTLAMITEMVFSWPGLGRWLIHAIRQQDYAAISAGVMVIGSLVIVVNVISDI
SAPB_SALTI      NALPPVIPRLGLQFSTM-LTLAMITEMVFSWPGLGRWLIHAIRQQDYAAISAGVMVIGSLVIVVNVISDI
OPPB2_STAAW     KPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIADL
OPPB2_STAAS     KPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIADL
OPPB2_STAAN     KPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIADL
OPPB2_STAAM     KPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIADL
OPPB2_STAAC     KPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIADL
OPPB2_STAA8     KPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIADL
OPPB2_STAA3     KPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIADL
SAPB_ECOLI      NALPPVIPRLGLQFSTM-LTLAMITEMVFSWPGLGRWLINAIRQQDYAAISAGVMVCGSLVIIVNVISDI
SAPB_ECO57      NALPPVIPRLGLQFSTM-LTLAMITEMVFSWPGLGRWLINAIRQQDYAAISAGVMVCGSLVIIVNVISDI
AMIC_STRR6      NAMVPLVSXXXXXXXXXXXXXTLT-ETVFAFPGMGKMLIDSVKASNNSMVVGLVFIFTCISIFSRLLGDI
AMIC_STRPN      NAMVPLVSXXXXXXXXXXXXXTLT-ETVFAFPGMGKMLIDSVKASNNSMVVGLVFIFTCISIFSRLLGDI
OPPB2_STAAR     KPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIADL
OPPB2_STAAB     KPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIADL
Y1314_MYCBO     TALIPMATLF-AYGVAGLVTGAVFVEKIFGWHGMGEWMVRGISTQDTNIVAAITVFSGAVVLLAGLLSDV
Y1283_MYCTU     TALIPMATLF-AYGVAGLVTGAVFVEKIFGWHGMGEWMVRGISTQDTNIVAAITVFSGAVVLLAGLLSDV
OPPB_MYCPN      NSIIPSVPLF-VXXXXXXXXXXXXXXXLFGVQGVSRILIDSVQSNETNLVMFNIMFIQGIPLLASVFIEL
OPPB_MYCGE      NSIIPSIPLF-VXXXXXXXXXXXXXXXLFGVQGVSILIDSVQVNETNMVMFNILFI-QGIPLLASVFIEF
SAPB_HAEIN      NTFPLLVPQVPRVF-TLVLTQCMLVETALGWPGIGRWLINAVNEQDY-----------------------
YEJE_ECOLI      NAMVATLTFLPFILCSSITT--------------------------------------------------
Y207_BRUME      NCLAPLLV--TLTFV---FAYAILAEATLSFLGIGTWGSIVAQGRDYSVDAWWIMLFTISALAINLIGDG
Y1051_BRUA2     NCLAPLLV--TLTFV---FAYAILAEATLSFLGIGTWGSIVAQGRDYSVDAWWIMLFTISALAINLIGDG
Y1032_BRUAB     NCLAPLLV--TLTFV---FAYAILAEATLSFLGIGTWGSIVAQGRDYSVDAWWIMLFTISALAINLIGDG
Y1093_BRUSU     NCLAPLLV--TLTFV---FAYAILAEATLSFLGIGTWGSIVAQGRDYSVDAWWIMLFTISALAINLIGDG
RS14_PROA2      KLAL------------------------------------------------------------------
OPPC_BACSU      NAMGSILVTMTLTVPTAIFT-----EAFLSYLGLGV----------------------------------
OPPC_LACLS      NLSTLVIA--EATLV---FAGNIGLETGLSFLGFGL----------------------------------
RS14_PROVI      KLAL------------------------------------------------------------------
OPPC_LACLA      NLSTLVIA--EATLV---FAGNIGLETGLSFLGFGL----------------------------------
RS14_PELLD      KLAL------------------------------------------------------------------
DDPB_ECOLI      NALIPSIT-XXXXXXXXXXXXXXXTETVFAWPGMGAWVVTSIQALDFPAVMGFAVVVSFAXXXXXXXXXX


                         .         .         .         .         *         .         .:420
query           SYTLVDPRIDFEGR
YEJB_ECOLI      SYTLVDPRIDFEGR
YEJB_ECO57      SYTLVDPRIDFEGR
APPB_BACSU      LYAIVDPRIEY---
OPPB_SALTY      LYAVIDPKIRY---
OPPB_SHIFL      LYAVIDPKIRY---
OPPB_ECOLI      LYAVIDPKIRY---
OPPB_ECOL6      LYAVIDPKIRY---
OPPB_ECO57      LYAVIDPKIRY---
Y4TP_RHISN      AYTLIDPRIRY---
Y1092_BRUSU     LYTIADPRVHYD--
DPPB_BACSU      AYGLLDPRI-----
Y209_BRUME      LYTIADPRVRYD--
Y1050_BRUA2     LYTIADPRVRYD--
Y1031_BRUAB     LYTIADPRVRYD--
DPPB_ECOLI      LYGVVNPRI-----
DPPB_ECOL6      LYGVVNPRI-----
DPPB_ECO57      LYGVVNPRI-----
OPPB_HAEIN      LYAIIDPKIRY---
DPPB_HAEIN      LYGVVNPRI-----
OPPB_BACSU      XYGIIDPRI-----
DPPB_BACPF      LYSYIDPRIKY---
GSIC_SALPA      LYAAINPAIRYK--
GSIC_SALTY      LYAAINPAIRYK--
GSIC_SALTI      LYAAINPAIRYK--
GSIC_SALCH      LYAAINPAIRYK--
NIKB_ECOLI      LNAALDPRI-----
OPPB_LACLS      IMAMVDPRI-----
OPPB_LACLA      IMAMVDPRI-----
Y3860_BRUME     AYAVIDPRI-----
Y3408_BRUSU     AYAVIDPRI-----
Y2551_BRUO2     AYAVIDPRI-----
GSIC_ERWCT      LYAAINPAIRYK--
GSIC_SHISS      LYAAINPAIRYK--
GSIC_SHIDS      LYAAINPAIRYK--
GSIC_ECOUT      LYAAINPAIRYK--
GSIC_ECOLI      LYAAINPAIRYK--
GSIC_ECOL5      LYAAINPAIRYK--
GSIC_ECOK1      LYAAINPAIRYK--
GSIC_ECO57      LYAAINPAIRYK--
GSIC_SHIFL      LYAAINPAIRYK--
GSIC_SHIF8      LYAAINPAIRYK--
GSIC_ECOL6      LYAAINPAIRYK--
GSIC_SHIBS      LYAAINPAIRYK--
SAPB_SALTY      LGAMANP-------
SAPB_SALTI      LGAMANP-------
OPPB2_STAAW     LTLLLDPK------
OPPB2_STAAS     LTLLLDPK------
OPPB2_STAAN     LTLLLDPK------
OPPB2_STAAM     LTLLLDPK------
OPPB2_STAAC     LTLLLDPK------
OPPB2_STAA8     LTLLLDPK------
OPPB2_STAA3     LTLLLDPK------
SAPB_ECOLI      LGAMANP-------
SAPB_ECO57      LGAMANP-------
AMIC_STRR6      WMTIIDPRI-----
AMIC_STRPN      WMTIIDPRI-----
OPPB2_STAAR     LTLLLDPK------
OPPB2_STAAB     LTLLLDPK------
Y1314_MYCBO     IYAALDPRV-----
Y1283_MYCTU     IYAALDPRV-----
OPPB_MYCPN      IYVLVDPRI-----
OPPB_MYCGE      IYVLVDPRI-----
SAPB_HAEIN      --------------
YEJE_ECOLI      --------------
Y207_BRUME      LRDVLDPRLKMEG-
Y1051_BRUA2     LRDVLDPRLKMEG-
Y1032_BRUAB     LRDVLDPRLKMEG-
Y1093_BRUSU     LRDVLDPRLKVEG-
RS14_PROA2      --------------
OPPC_BACSU      --------------
OPPC_LACLS      --------------
RS14_PROVI      --------------
OPPC_LACLA      --------------
RS14_PELLD      --------------
DDPB_ECOLI      XXXWIDPRI-----