[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF65871.1

[Show Plain Result]


## Summary of Sequence Search
    1::401
    1::401       0.0  95%  401 aa  YEDE_SALTY RecName: Full=UPF0394 inner membrane protein yedE;
    1::399       0.0  86%  401 aa  YEDE_ECOLI RecName: Full=UPF0394 inner membrane protein yedE;
  254::330     3e-08  27%  352 aa  YEEE_ECOLI RecName: Full=UPF0394 inner membrane protein yeeE;
    1::401

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSWQHFKQTWLIKFWAPAPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQILQLFGVHAEQWGYYKLIH
YEDE_SALTY      MSWQHFKQTWLIKFWAPAPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQILQLFGVHAEQWGYYKLIH
YEDE_ECOLI      MSWQQFKHAWLIKFWAPIPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQLLQLFGVHAEEWGYFKIIH
YEEE_ECOLI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LEGTPLTRIDGMMILGMFGGCFAAALWANNVKLRMPRSRIRIVQAVVGGMIAGFGARLAMGCNLAAFFTG
YEDE_SALTY      LEGTPLTRIDGMMILGMFGGCFAAALWANNVKLRMPRSRXXXXXXXXXXXXXXXXXXLAMGCNLAAFFTG
YEDE_ECOLI      LEGSPLTRIDGMMILGMFGGCFAAALWANNVKLRMPRSXXXXXXXXXXXXXXXXXXXXXMGCNLAAFFTG
YEEE_ECOLI      ------------LVLGIFVGSFIAAKASREFRVRAADAQTTL-RSGLGGVLMGFGASIAGGCSIGNGLVM


                         +         .         .         .         .         *         .:210
query           IPQFSLHAWFFALATAIGSWFGARFTLLPIFRIPVKMQKVSAASPLTQKPDQARRRFRLGMLVFIGMIGW
YEDE_SALTY      IPQFSLHAWFFALATAIGSWFGARFTLLPIFRIPVKMQKVSAASPLTQKPDQARRRFRLGMLVFIGMIGW
YEDE_ECOLI      IPQFSLHAWFFAIATAIGSWFGARFTLLPIFRIPVKMQKVSAASPLTQKPDQARRRFRLGMLVFFGMLGW
YEEE_ECOLI      TAMMTWQGWIGLVFMILGVW--------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ALLTAMHQPKLGLAMLFGIGFGLLIERAQICFTSAFRDLWISGRAHMAKAIIFGMAVSAIGIFSYVQLGV
YEDE_SALTY      ALLTAMHQPKLGLAMLFGVGFGLLIERAQICFTSAFRDLWISGRAHMAKAIIFGMAVSAIGIFSYVQLGV
YEDE_ECOLI      ALLTAMNQPKLGLAMLFGVGFGLLIERAQICFTSAFRDMWITGRTHMAKAIIIGMAVSAIGIFSYVQLGV
YEEE_ECOLI      --------------LICGALLGFVMQRGRFCLTGGFRDMYIVKNNRMFYALLIAISVQSVGVFALIQAGL


                         .         *         .         .         .         .         +:350
query           APKIMWAGPNXXXXXXXXXXXXXXXXXCETGWMYRAVEGQVHYWWVGLGNVIGSTILAYYWDDFAPALAT
YEDE_SALTY      APKIMWAGPNXXXXXXXXXXXXXXXXXCETGWMYRAVEGQVHYWWVGLGNVIGSTILAYYWDDFAPALAT
YEDE_ECOLI      EPKIMWAGPNXXXXXXXXXXXXXXXXXCETGWMYRAVEGQVHYWWVGLGNVIGSTILAYYWDDFAPALAT
YEEE_ECOLI      AGAFPWLG--TVIGGYIFGLGIVLAGGCATGTWYRAGEGLIGSW--------------------------


                         .         .         .         .         *         .         .:420
query           SWDKVNLLNTFXXXXXXXXXXXXXXXXXXXXXXWEKRFFRRAGLTPAKESV
YEDE_SALTY      SWDKVNLLNTFXXXXXXXXXXXXXXXXXXXXXXWEKRFFRRAGLTPAKESV
YEDE_ECOLI      DWDKINLLKTFGPMGGXXXXXXXXXXXXXXIIGWEKRFFRRAAPQTAKE--
YEEE_ECOLI      ---------------------------------------------------