[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF65890.1

[Show Plain Result]


## Summary of Sequence Search
    1::350
    1::350       0.0  92%  350 aa  AROG_ECOLI RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    1::350       0.0  92%  350 aa  AROG_ECO57 RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   12::357     e-137  69%  362 aa  AROG_HAEIN RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    3::347     e-109  55%  348 aa  AROH_SALTY RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    3::347     e-109  54%  348 aa  AROH_SALTI RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    3::347     e-108  55%  348 aa  AROH_ENTAG RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    3::347     e-105  53%  348 aa  AROH_ECO57 RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    3::347     e-104  53%  348 aa  AROH_ECOL6 RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    3::347     e-104  53%  348 aa  AROH_ECOLI RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    3::347     e-104  53%  348 aa  AROH_SHIFL RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    3::347     e-102  53%  348 aa  AROH_BUCBP RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   18::366     e-102  54%  372 aa  AROG_SCHPO RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   21::365     e-100  56%  370 aa  AROG_YEAST RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   18::366     e-100  51%  368 aa  AROF_SCHPO RecName: Full=Putative
    7::343     3e-99  54%  356 aa  AROF_ECOLI RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    7::343     3e-97  53%  356 aa  AROF_SALTY RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    7::343     3e-97  53%  356 aa  AROF_SALTI RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    3::347     4e-97  51%  348 aa  AROH_BUCAP RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    3::347     1e-95  50%  348 aa  AROH_BUCAI RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   15::365     5e-95  53%  370 aa  AROF_YEAST RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   11::361     9e-90  52%  370 aa  AROG_CANAL RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   15::366     2e-81  51%  368 aa  AROF_CANAL RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   17::337     6e-81  50%  366 aa  AROG_CORGL RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    1::197     1e-59  55%  213 aa  AROF_ENTAG RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
   35::203     1e-49  53%  203 aa  AROG_AMYME RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
    1::350

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNYQNDDLRIKEINELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCSIHDPXXXX
AROG_ECOLI      MNYQNDDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCSIHDPVAAK
AROG_ECO57      MNYQNDDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCSIHDPVAAK
AROG_HAEIN      ----NDDTRIEKVDQVLPPIALLEKYPASEQAAALVKQTRHEAHNIIHGKDDRLLVVIGPCSIHDPKAAI
AROH_SALTY      ---RTDELRTARIDSLVTPTELAQRYPVSSSVASHVTDSRRRIEKILNGEDPRLLVVIGPCSIHDLNAAM
AROH_SALTI      ---RTDELRTARIDSLVTPTELAQRYPVSSSVASHVTDSRRRIEKILNGEDPRLLVVIGPCSIHDLNAAM
AROH_ENTAG      ---KTDELRTARIGSLITPPSLAAEHPVSPAIADNVTAARKRIACILTGEDHRLLVVIGPCSLHDPKAAL
AROH_ECO57      ---RTDELRTARIESLVTPAELALRYPVTPGVATHVTDSRRRIEKILNGEDKRLLVIIGPCSIHDLTAAM
AROH_ECOL6      ---RTDELRTARIESLVTPAELALRYPVTPGVATHVTDSRRRIEKILNGEDKRLLVIIGPCSIHDLTAAM
AROH_ECOLI      ---RTDELRTARIESLVTPAELALRYPVTPGVATHVTDSRRRIEKILNGEDKRLLVIIGPCSIHDLTAAM
AROH_SHIFL      ---RTDELRTARIESLVTPAELALRYPVTPGVATHVTDSRRRIEKILNGEDKRLLVIIGPCSIHDLTAAM
AROH_BUCBP      ---KTDELRTIRIDPLVTPAELAQRHVITPSIMDTVISTRKNIANIMTGLDPRLLVIIGPCSVHDPVAAV
AROG_SCHPO      -----DDNRVLGYNPLVPAALVQQEIPVSETSRKVITDSRKEIQAILNKQDDRIIVVVGPCSIHDPKLAM
AROG_YEAST      -----EDVRILGYDPLASPALLQVQIPATPTSLETAKRGRREAIDIITGKDDRVLVIVGPCSIHDLEAAQ
AROF_SCHPO      ---KTEDSRIKGYDPVISPALIQSELAASDETLAFVSDQRRQAADIIAGRDDRLLLIVGPCSLHDPVAAK
AROF_ECOLI      -----NNVHITDEQVLMTPEQLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCGPCSIHDPETAL
AROF_SALTY      -----NNVRITDEQVLMTPEQLKAAFPLSLAQEAQIAQSRGIISDIIAGRDPRLLVVCGPCSIHDPETAL
AROF_SALTI      -----NNVRITDEQVLMTPEQLKAAFPLSLAQEAQIAQSRGIISDIIAGRDPRLLVVCGPCSIHDPETAL
AROH_BUCAP      ---KTDELRTIRIDPLITPSELAKKYAITSEIMDNVIITRQNIARIMTGEDLRLLVVIGPCSVHDPIAAV
AROH_BUCAI      ---KTDELRTIRIDPLITPAELARQYAITSDIMDTVIATRQNIARIMTGQDARLLVVIGPCSVHDPIAAV
AROF_YEAST      -----EDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKDDRLVIVIGPCSLHDPKAAY
AROG_CANAL      -----DDTRILGYDPLVPPALLQHEIKASAESLDVVIKGRYDSAQILKGNDDRCIVIVGPCSIHDPPQAL
AROF_CANAL      -----EDWRIRGYDPLTPPDLLQHEYPLTPESQKIIVEGRNAACDILNGKDRRL---IGPCSIHDPQAAL
AROG_CORGL      --------RVVAFHELPSPTDLIAANPLTPKQASKVEQDRQDIADIFAGDDDRLVVVVGPCSVHDPEAAI
AROF_ENTAG      ----------------------------------------------------------------------
AROG_AMYME      -----DNQRTLGVSPLISPALLRQELPVDAAIAKTVAHGRSSAVDILHGDDDRLIVVVGPCSVHDPAAAL


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXRDELQGELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPA
AROG_ECOLI      EYATRLLALREELKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPA
AROG_ECO57      EYATRLLALREELKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPA
AROG_HAEIN      EYATRLKPLREKYKDSLEIIMRVYFEKPRTTVGWKGLINEPYLNDTYRLNDGLRIARKLLSDINDLGVPA
AROH_SALTY      EYATQLQAQRQKHQARLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRVNYGLELARRLLLQVNELGVPT
AROH_SALTI      EYATQLQAQRQKHQARLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRVNHGLELARRLLLQVNELGVPT
AROH_ENTAG      EYAERLNALRRRYEDRLEIVMRAYFEKPRTVVGWKGLISDPDLDGSYDVNRGIGIARQLLIDINALGLPT
AROH_ECO57      EYATRLQSLRNQYQSRLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRINHGLELARKLLLQVNELGVPT
AROH_ECOL6      EYATRLQSLRNQYQSRLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRVNHGLELARKLLLQVNELGVPT
AROH_ECOLI      EYATRLQSLRNQYQSRLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRVNHGLELARKLLLQVNELGVPT
AROH_SHIFL      EYATRLQSLRNQYQSRLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRVNHGLELARKLLLQVNELGVPT
AROH_BUCBP      EYAGRLQVLRKKYESRLEIVMRTYFEKPRTVIGWKGLISDPDLNGSFHVNNGLSIARKLLLDINKLGVPA
AROG_SCHPO      DYAKLLKPKADELQDALCVVMRCYLEKPRTTIGWKGLVNDPNLDGSFAINKGIRMARQMYCDVTNFGIPL
AROG_YEAST      EYALRLKKLSDELKGDLSIIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQSARQLFVNLTNIGLPI
AROF_SCHPO      EYAIRLQKEAIKHKKDLHIIMRAYLEKPRTTVGWKGLINDPDLDGSYNINKGIRVARRIFLELLETGVGI
AROF_ECOLI      EYARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLQIARKLLLELVNMGLPL
AROF_SALTY      EYARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLKIARQLLVELVNMGLPL
AROF_SALTI      EYARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLKIARQLLVELVNMGLPL
AROH_BUCAP      EYAHRLYELRKKYQDRLEIIMRTYFEKPRTVVGWKGLISDPDLNGSFRVNHGLAVARKLLLDINELGMPA
AROH_BUCAI      EYAHRLYELRVKYKDRLEIIMRTYFEKPRTVVGWKGLISDPDLNGSFRVNHGLAVARKLLLDINALGMPA
AROF_YEAST      DYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDMNNSFQINKGLRISREMFIKLVEK-LPI
AROG_CANAL      EYGXXXXXXXXXXXXXXVIIMRAYLEKPRTTVGWKGLINDPDVDNSFDINRGLKISRQLYSDLTSVGLPI
AROF_CANAL      DYCERLYQASEKHKGELLIVMRAYLEKPRTTVGWKGLINDPDIDGTFHINKGLRIARKLFVQLT-SKLPI
AROG_CORGL      DYANRLAPLAKRLDQDLKIVMRVYFEKPRTIVGWKGLINDPHLNETYDIPEGLRIARKVLIDVVNLDLPV
AROF_ENTAG      ----------------------------------------------------------------------
AROG_AMYME      DYAHRLAEHAAGVRDELHVIMRVYFEKPRTTLGWKGLINDPDLDGSYAVNKGLRMARKLLLDISALGLPV


                         +         .         .         .         .         *         .:210
query           AGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFL
AROG_ECOLI      AGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFL
AROG_ECO57      AGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFL
AROG_HAEIN      AGEFLDMITPQYLADFMSWGAIGARTTESQVHRELASGLSCAVGFKNATNGGVKVALDAIGAAEAPHYFL
AROH_SALTY      ATEFLDMVTGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNTRIAVDAIRASRASHMFL
AROH_SALTI      ATEFLDMVTGQFIADLISWGTIGARTTESQIHREMASALSCPVGFKNGTDGNTRIAVDAIRASRASHMFL
AROH_ENTAG      ATEFLDMVIGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNVQIAVDAIRAARASHMFL
AROH_ECO57      ATEFLDMVTGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNTXXXXXXXXXXXXSHMFL
AROH_ECOL6      ATEFLDMVTGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNTXXXXXXXXXXXXSHMFL
AROH_ECOLI      ATEFLDMVTGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNTXXXXXXXXXXXXSHMFL
AROH_SHIFL      ATEFLDMVTGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNTXXXXXXXXXXXXSHMFL
AROH_BUCBP      ATEFLDMVIGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNIRIAVDAIRAASVEHLFL
AROG_SCHPO      ASEMLDNISPQFFADLLSFGAIGARTTESQLHRELASALSFPVGFKNGTDGTVGVAIDAIGATAHPHTML
AROG_YEAST      GSEMLDTISPQYLADLVSFGAIGARTTESQLHRELASGLSFPVGFKNGTDGTLNVAVDACQAAAHSHHFM
AROF_SCHPO      ASEMLDTISPQYLADLICWGAIGARTTESQLHRELASGLSFPIGFKNATDGNIGIAIDAMNSSANPHHFL
AROF_ECOLI      ATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVGFKNGTDGSLATAINAMRAAAQPHRFV
AROF_SALTY      ATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVGFKNGTDGSLATAINAMRAAAQPHRFV
AROF_SALTI      ATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVGFKNGTDGSLATAINAMRAAAQPHRFV
AROH_BUCAP      ATEFLDMVIGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNXXXXXXXXXXXXXXHLFF
AROH_BUCAI      ATEFLDIVIGQFIADLISWGAIGARTTESQIHREMASALSCPVGFKNGTDGNXXXXXXXXXXXKVRHLFF
AROF_YEAST      AGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFL
AROG_CANAL      GSEMLDTISPQYFSDFLSFGAIGARTTESQLHRELASGLSFPIGFKNGTDGGLAVALDAVQASSKGHHFM
AROF_CANAL      AGEMLDTISPQFLSDLFSVGAIGARTTESQLHRELASGYHSQLDSKTVPMVLWVLPLTPLRAASHPHHFL
AROG_CORGL      GCEFLEPNSPQYYADTVAWGAIGARTTESQVHRQLASGMSMPIGFKNGTDGNIXXXXXXXXXXXNPHFFF
AROF_ENTAG      -----DPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVGFKNGTDGSLGTAINAMRAAAMPHRFV
AROG_AMYME      GCEFLDPITPQFIADTVSWGSIGARTAASQVHRQ------------------------------------


                         .         .         .         +         .         .         .:280
query           SVTKWGHSAIVNTSGNGDCHIILRGGKAPNYSAQHVAEVKEGLIKAGLTPQVMIDFSHANSCKQFQKQME
AROG_ECOLI      SVTKWGHSAIVNTSGNGDCHIILRGGKEPNYSAKHVAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMD
AROG_ECO57      SVTKWGHSAIVNTSGNGDCHIILRGGKEPNYSAKHVAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMD
AROG_HAEIN      SVTKFGHSAIVSTKGNEDCHIILRGGKGPNYSAEDVEKVCADIEKTGRIPHVMVDFSHANSSKQYKKQMD
AROH_SALTY      SPDKDGQMTIYQTSGNPYGHIIMRGGKKPNYHAEDIAAACDTLHEFDLPEHLVVDFSHGNCQKQHRRQLE
AROH_SALTI      SPDKDGQMTIYQTSGNPYGHIIMRGGKKPNYHAEDIAAACDTLHEFDLPEHLVVDFSHGNCQKQHRRQLD
AROH_ENTAG      SPDKLGQMTIYQTSGNPHGHVILRGGKQPNYHASDVAAAAESLSAFNLPQQLVIDFSHGNCLKQHRRQMD
AROH_ECO57      SPDKNGQMTIYQTSGNPYGHIIMRGGKKPNYHADDIAAACDTLHEFDLPEHLVVDFSHGNCQKQHRRQLE
AROH_ECOL6      SPDKNGQMTIYQTSGNPYGHIIMRGGKKPNYHADDIAAACDTLHEFDLPEHLVVDFSHGNCQKQHRRQLE
AROH_ECOLI      SPDKNGQMTIYQTSGNPYGHIIMRGGKKPNYHADDIAAACDTLHEFDLPEHLVVDFSHGNCQKQHRRQLE
AROH_SHIFL      SPDKNGQMTIYQTSGNPYGHIIMRGGKKPNYHADDIAAACDTLHEFDLPEHLVVDFSHGNCQKQHRRQLE
AROH_BUCBP      APNKYGQMTINYTSGNPFGHVIMRGGKSPNYHAKDIAIAIKYLHEFTLSEYLMIDFSHGNCLKQHRRQLD
AROG_SCHPO      GVTKQGLAAITMTRGNKDTFIILRGGKGPNYDAEHVAAVRKDLEKANLPPRIMIDCSHGNSSKNHLNQPK
AROG_YEAST      GVTKHGVAAITTTKGNEHCFVILRGGKGTNYDAKSVAEAKAQL-PAG-SNGLMIDYSHGNSNKDFRNQPK
AROF_SCHPO      SVTKQGVVAIVTTTGNPDTHIILRGGKSTNFDADSVAGAKAKLEECNKLPSIMIDCSHGNSSKNHKNQPK
AROF_ECOLI      GINQAGQVALLQTQGNPDGHVILRGGKAPNYSPADVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPA
AROF_SALTY      GINQAGQVALLQTQGNPHGHVILRGGKAPNYSPADVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPA
AROF_SALTI      GINQAGQVALLQTQGNPHGHVILRGGKAPNYSPADVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPA
AROH_BUCAP      APNKDGQMTINHTSGNPYGHIIMRGGRTPNYHAHDINSAIEHLREFNLLEHLMIDFSHGNCLKEHIRQKD
AROH_BUCAI      APNKDGQMTINHTSGNPYGHIIMRGGRAPNYHPDDINSAVKHLREFDLLEHLMIDFSHGNCLKEHLRQKN
AROF_YEAST      SVTKPGVTAIVGTEGNKDTFLILRGGKGTNFDKESVQNTKKQLEKAGLTKRIMIDCSHGNSNKDFKNQPK
AROG_CANAL      GVTKNGMAAITTTKGNDCCFIILRGGKITNYDVESVKAAKEAIAKTDPSIKLMVDCSHDNSRKDYRNQPQ
AROF_CANAL      SVTKPGVVAIVGTDGNQDCFVILRGGKGTNYDAKSVQETQEELIKSKVVPRIMVDCSHGNSNKDHRNQPK
AROG_CORGL      GTSDDGALSVVETAGNSNSHIILRGGSGPNHDAASVEAVVE---KLGENARLMIDASHANSGKDHIRQVE
AROF_ENTAG      GINQAGQVCLLQTQGNPDGHVILRGGKAPNYGPEDVAQCEKEMLKAGLRPALMIDCSHGNSNKDYSRQPG
AROG_AMYME      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VCADVCQQIAGGEKAIIGVMVESHLVEGNQSLESGQPLTYGKSITDACIGWEDTDALLRQLSAAVKARRG
AROG_ECOLI      VCADVCQQIAGGEKAIIGVMVESHLVEGNQSLESGEPLAYGKSITDACIGWEDTDALLRQLANAVKARRG
AROG_ECO57      VCADVCQQIAGGEKAIIGVMVESHLVEGNQSLESGEPLAYGKSITDACIGWEDTDALLRQLANAVKARRG
AROG_HAEIN      VCQDVCNQIAFGSKQIFGVMVESHLVEGRQDLVDGKAQTYGQSITDACIGWEDSERLLQQLSDAVIARR-
AROH_SALTY      VCDDICQQIRNGSTAIAGIMAESFLREGTQKIISGQPLIYGQSITDPCLNWEDTEVLLEKLAAAVDSR--
AROH_SALTI      VCDDICQQIRNGSTAIAGIMAESFLREGTQKIISGQPLIYGQSITDPCLNWEDTEVLLEKLAAAVDSR--
AROH_ENTAG      VAAEVAEQIKAGSQAVAGVMIESFLEEGNQKVVSGEPLVYGKSITDPCLGWQESEKVLALLAEAVSHR--
AROH_ECO57      VCEDICQQIRNGSTAIAGIMAESFLREGTQKIVGGQPLTYGQSITDPCLGWEDTERLVEKLASAVDTR--
AROH_ECOL6      VCEDICQQIRNGSTAIAGIMAESFLREGTQKIVGGQPLTYGQSITDPCLGWEDTERLVEKLASAVDTR--
AROH_ECOLI      VCEDICQQIRNGSTAIAGIMAESFLREGTQKIVGSQPLTYGQSITDPCLGWEDTERLVEKLASAVDTR--
AROH_SHIFL      VCEDICQQIRNGSTEIAGIMAESFLREGTQKIVGGQPLTYGQSITDPCLGWEDTERLVEKLAFAVDTR--
AROH_BUCBP      VGESIAKQIRDGSTAIFGVMIESFLEEGSQKVIDNKSLVYGKSITDPCLGWNDSAFLLEKLANAVDSR--
AROG_SCHPO      VSKSIAEQIRNGDSSIVGVMIESHINEGRQDIRPGDTLKYGVSITDACVSWEQTAPMLDDLAEAVRARR-
AROG_YEAST      VNDVVCEQIANGENAITGVMIESNINEGNQGIEGKAGLKYGVSITDACIGWETTEDVLRKLAAAVRQRR-
AROF_SCHPO      VAACIAEQVANGQKAITGVMIESHLNEGKQAIDDLSSMKYGVSVTDACIGWDDTTAVFEQLAAAVRSRR-
AROF_ECOLI      VAESVVAQIKDGNRSIIGLMIESNIHEGNQSSEQPREMKYGVSVTDACISWEMTDALLREI---------
AROF_SALTY      VAESVVAQIKDGNRSIIGLMIESNIHEGNQSSEQPREMKYGVSVTDACISWEMTDALLREI---------
AROF_SALTI      VAESVVAQIKDGNRSIIGLMIESNIHEGNQSSEQPREMKYGVSVTDACISWEMTDALLREI---------
AROH_BUCAP      VAKSVSKQISQGSKTIFGVMIESFLEEGFQTVKENQPLIYGKSITDACLNWKDSVLIIKQLADAVDTR--
AROH_BUCAI      VSKSVSYQISHGSKAIFGVMIESFLEEGFQTVTNNQPLIYGKSITDACLNWKDSVLIIEQLADAVDAR--
AROF_YEAST      VAKCIYDQLTEGENSLCGVMIESNINEGRQDIEGGEGLKYGCSVTDACIGWESTEQVLELLAEGVRNRR-
AROG_CANAL      VLDSVAEQISNGEDSIIGVMIESNIHEGKQPMSGKEALKYGVSITDGCVSWETTVEMLTKLSQAVQTRR-
AROF_CANAL      XXXXXXXXXXGGDKSICGLMIESNINDGRQDVEQGDALKYGVSITDACIGWETTEEVLEVLANAVKTRR-
AROG_CORGL      VVREIAEQISGGSEAVAGIMIESFLVGGAQNLDGGEGLVYGQSV--------------------------
AROF_ENTAG      VAESAIAQIKDGNRSIIGLMLESHINEGNQSSEQPREMKYGVSVTDACINWEVTETLLREM---------
AROG_AMYME      ----------------------------------------------------------------------