[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF65897.1

[Show Plain Result]


## Summary of Sequence Search
    1::73
    1::71      3e-16  45%   72 aa  YGDR_SHIFL RecName: Full=Uncharacterized lipoprotein ygdR;Flags:
    1::71      3e-16  45%   72 aa  YGDR_ECOLI RecName: Full=Uncharacterized lipoprotein ygdR;Flags:
    1::71      3e-16  45%   72 aa  YGDR_ECOL6 RecName: Full=Uncharacterized lipoprotein ygdR;Flags:
    1::71      3e-16  45%   72 aa  YGDR_ECO57 RecName: Full=Uncharacterized lipoprotein ygdR;Flags:
    1::74      3e-15  47%   75 aa  YGDI_ECOLI RecName: Full=Uncharacterized lipoprotein ygdI;Flags:
    1::74      3e-15  47%   75 aa  YGDI_ECOL6 RecName: Full=Uncharacterized lipoprotein ygdI;Flags:
    1::73

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKLFICSGLGMMFFMLAGCTTNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQREINSNDVAQLI
YGDR_SHIFL      MKKWAVIISAVGLAFAVSGCSSDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQII
YGDR_ECOLI      MKKWAVIISAVGLAFAVSGCSSDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQII
YGDR_ECOL6      MKKWAVIISAVGLAFAVSGCSSDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQII
YGDR_ECO57      MKKWAVIISAVGLAFAVSGCSSDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQINRDDVSQII
YGDI_ECOLI      MKKTAAIISACMLTFALSACSSNYVMHTNDGRTIVSDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMV
YGDI_ECOL6      MKKTAAIISACMLTFALSACSSNYVMHTNDGRTIVSDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMV


                         .         .         *         .         .         .         .:140
query           KAD
YGDR_SHIFL      E--
YGDR_ECOLI      E--
YGDR_ECOL6      E--
YGDR_ECO57      E--
YGDI_ECOLI      ELD
YGDI_ECOL6      ELD