[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for sent8:ACF65921.1

[Show Plain Result]


## Summary of Sequence Search
    1::467
    6::444     2e-80  36%  468 aa  CYDA_BACSU RecName: Full=Cytochrome d ubiquinol oxidase subunit 1; 
    2::512     1e-74  38%  514 aa  APPC_ECOLI RecName: Full=Cytochrome bd-II oxidase subunit 1;       
    3::522     1e-66  34%  522 aa  CYDA_SHIFL RecName: Full=Cytochrome d ubiquinol oxidase subunit 1; 
    3::522     1e-66  34%  522 aa  CYDA_ECOLI RecName: Full=Cytochrome d ubiquinol oxidase subunit 1; 
    3::522     1e-66  34%  522 aa  CYDA_ECOL6 RecName: Full=Cytochrome d ubiquinol oxidase subunit 1; 
    9::311     4e-59  37%  537 aa  CYDA_AZOVI RecName: Full=Cytochrome d ubiquinol oxidase subunit 1; 
    3::309     2e-58  36%  521 aa  CYOA_HAEIN RecName: Full=Probable cytochrome oxidase subunit 1;    
    1::467

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxFDAFFLARLQFAFTVSFHIIFPAITIGLASYLVVLEGLWLKTRNPVWRSLYQFWLKIFAVNFGMGVVS
CYDA_BACSU      -------LARIQFASTTLFHFLFVPMSIGLVFMVALMETLYLVKKNELYLKMAKFWGHLFLINFAVGVVT
APPC_ECOLI      --WDVIDLSRWQFALTALYHFLFVPLTLGLIFLLAIMETIYVVTGKTIYRDMTRFWGKLFGINFALGVAT
CYDA_SHIFL      ---DIVELSRLQFALTAMYHFLFVPLTLGMAFLLAIMETVYVLSGKQIYKDMTKFWGKLFGINFALGVAT
CYDA_ECOLI      ---DIVELSRLQFALTAMYHFLFVPLTLGMAFLLAIMETVYVLSGKQIYKDMTKFWGKLFGINFALGVAT
CYDA_ECOL6      ---DIVELSRLQFALTAMYHFLFVPLTLGMAFLLAIMETVYVLSGKQIYKDMTKFWGKLFGINFALGVAT
CYDA_AZOVI      -------LSRLQFAMTALYHFLFVPLTLGMTFLLAIMESVYVMTGKQVYKDMVKFWGKLFGINFALGVTT
CYOA_HAEIN      ---DVVDLSRLQFALTALYHFIFVPLTLGLSFILVIMETIYVATGKEVYKDMTKFWGKLFGINFALGVTT


                         .         .         *         .         .         .         .:140
query           GLVMAYQFGTNWSGFSQFAGSITGPLLTYEVLTAFFLEAGFLGVMLFGWNKVGPGLHFLSTCMVALGTLM
CYDA_BACSU      GILQEFQFGLNWSDYSRFVGDVFGAPLAIEALLAFFMESIFIGLWIFGWDRLPKKIHALCIWLVSFGTIM
APPC_ECOLI      GLTMEFQFGTNWSFYSNYVGDIFGAPLAMEALMAFFLESTFVGLFFFGWQRLNKYQHLLVTWLVAFGSNL
CYDA_SHIFL      GLTMEFQFGTNWSYYSHYVGDIFGAPLAIEGLMAFFLESTFVGLFFFGWDRLGKVQHMCVTWLVALGSNL
CYDA_ECOLI      GLTMEFQFGTNWSYYSHYVGDIFGAPLAIEGLMAFFLESTFVGLFFFGWDRLGKVQHMCVTWLVALGSNL
CYDA_ECOL6      GLTMEFQFGTNWSYYSHYVGDIFGAPLAIEGLMAFFLESTFVGLFFFGWDRLGKVQHMCVTWLVALGSNL
CYDA_AZOVI      GITMEFQFGTNWAYYSHYVGDIFGAPLAIEGLTAFFLESTFIGMFFFGWDRLSKIQHLAVTWLVALGSNL
CYOA_HAEIN      GIIMEFQFGTNWSYYSHYVGDIFGXXXXXXXXXXXXXXSTFVGLFFFGWDRLSKGKHLLATYCVAFGSNL


                         +         .         .         .         .         *         .:210
query           STFWILASNSWMHTPQGFEIHNGQVVPVDWFAVIFNPSFPYRLLHMSVAAFLSSAMFVGASAAWHLLKGN
CYDA_BACSU      SSFWILTANSFMQEPVGFTIKNGRAEMNDFGALITNPQLWVEFPHVIFGALATGAFFIAGVSAFKLLKKK
APPC_ECOLI      SALWILNANGWMQYPTGFDIDTLRMEMTSFSELVFNPVSQVKFVHTVMAGYVTGAMFIMAISAWYLLRGR
CYDA_SHIFL      SALWILVANGWMQNPSDFNFETMRMEMVSFSELVLNPVAQVKFVHTVASGYVTGAMFILGISAWYMLKGR
CYDA_ECOLI      SALWILVANGWMQNPSDFNFETMRMEMVSFSELVLNPVAQVKFVHTVASGYVTGAMFILGISAWYMLKGR
CYDA_ECOL6      SALWILVANGWMQNPSDFNFETMRMEMVSFSELVLNPVAQVKFVHTVASGYVTGAMFILGISAWYMLKGR
CYDA_AZOVI      SALWILVANGWMQHPVGFNFETMRMELVDFGALLLNPVAQVKFVHTVASGYVTGAVFVLAISSYYLLKKR
CYOA_HAEIN      SAMWILVANGWMQAPTGFNFETVRMEMTNFLDLWLNPVAQSKFLHTLSAGYVTGAFFVLAISSYFLLKGR


                         .         .         .         +         .         .         .:280
query           DTPAIRRMFSMALWMAVVVAPVQALIGDMHGLNTLKHQPVKIAAIEGHWENTPGEPTPLTLVGWPDMEAE
CYDA_BACSU      EVPFFKQSFKLAMIVGLCAGLGVGLSGHMQAEHLMESQPMKMAASEGLWEDS-GDPAAWTAFATIDTKNE
APPC_ECOLI      ERNVALRSFAIGSVFGTLAIIGTLQLGDSSAYEVAQVQPVKLAAMEGEWQTEPA-PAPFHVVAWPEQDQE
CYDA_SHIFL      DFAFAKRSFAIAASFGMAAVLSVIVLGDESGYEMGDVQKTKLAAIEAEWETQPA-PAAFTLFGIPDQEEE
CYDA_ECOLI      DFAFAKRSFAIAASFGMAAVLSVIVLGDESGYEMGDVQKTKLAAIEAEWETQPA-PAAFTLFGIPDQEEE
CYDA_ECOL6      DFAFAKRSFAIAASFGMAAVLSVIVLGDESGYEMGDVQKTKLAAIEAEWETQPA-PAAFTLFGIPDQEEE
CYDA_AZOVI      DLGXXXXXXXXXXXXGMASILSVIVLGDESGYEVGEVQKAKLAAIEAEWETHPA-PASFTLIGFPNEEEQ
CYOA_HAEIN      DFEFAKRSFSVAATFGFIASISVLILGDESGYDIGKAQPVKLAAMEAEFETHPA-PAPFLPVAIPNTAEM


                         .         *         .         .         .         .         +:350
query           RTRYALEIPALGSLILTHSLDKQVPALKDYPKEDRPNSTVVFWSFRLMVGMGVLMIFLGLASLWLRYRRR
CYDA_BACSU      KSSNEIKVPYALSYLAYQKFSGSVKGMKTYGKGDYPPVKTTFWSFRIMVGAGVVMILAALGGLWLNRRKK
APPC_ECOLI      RNAFALKIPALLGILATHSLDKPVPGLKNLMAETYPQRGRMAWLLMQEISQGVLQAFLGYGMLLSRYAPD
CYDA_SHIFL      TNKYALGIPVIGELMVQHELKRYTPNVADATKDSIPRVAPLYFAFRIMVACGFLLLAIIALSFWSVIRNR
CYDA_ECOLI      TNKYALGIPVIGELMVQHELKRYTPNVADATKDSIPRVAPLYFAFRIMVACGFLLLAIIALSFWSVIRNR
CYDA_ECOL6      TNKYALGIPVIGELMVQHELKRYTPNVADATKDSIPRVAPLYFAFRIMVACGFLLLAIIALSFWSVIRNR
CYDA_AZOVI      RTDFAVKIPWVLGIIATRSLDEQVIGIKD-----------------------------------------
CYOA_HAEIN      KNDFAIEIPYLGGVIATRSIDKEIIGLKD-----------------------------------------


                         .         .         .         .         *         .         .:420
query           LYHSRPFMHFALWMGPSGLIAILAGWVTTEVGRQPWVVYGLLRTRDAVSAHSTLQMSISLLAFFVVYSLV
CYDA_BACSU      LENSKWYLRIMIALISFPFLANSAGWIMTEIGRQPWTVMGLMTTAQSVSPNVTASLLFSIIAFGVMYMIL
APPC_ECOLI      MNHAPVFWSFRIMVGPLPWIAIEAGWFMTEFGRQPWAIQDILPTYSAHSALTTGQLAFSLIMIVGLYTLF
CYDA_SHIFL      IGEKKWLLRAALYGIPLPWIAVEAGWFVAEYGRQPWAIGEVLPTAVANSSLTAGDLIFSMVLICGLYTLF
CYDA_ECOLI      IGEKKWLLRAALYGIPLPWIAVEAGWFVAEYGRQPWAIGEVLPTAVANSSLTAGDLIFSMVLICGLYTLF
CYDA_ECOL6      IGEKKWLLRAALYGIPLPWIAVEAGWFVAEYGRQPWAIGEVLPTAVANSSLTAGDLIFSMVLICGLYTLF
CYDA_AZOVI      ----------------------------------------------------------------------
CYOA_HAEIN      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FGVGYIYMIRLIQKGPQPAETPTAETDGRPARxxxxxxxxxxxxxxx
CYDA_BACSU      GALLVFLFIREIKKGAE------------------------------
APPC_ECOLI      LIAEVYLMQKYARLGPMQSEQPTQQ----------------------
CYDA_SHIFL      LVAELFLMFKFARLGPSSLKTEQSSTTTQPAR---------------
CYDA_ECOLI      LVAELFLMFKFARLGPSSLKTEQSSTTTQPAR---------------
CYDA_ECOL6      LVAELFLMFKFARLGPSSLKTEQSSTTTQPAR---------------
CYDA_AZOVI      -----------------------------------------------
CYOA_HAEIN      -----------------------------------------------